KEGG   Gallus gallus (chicken): 420668Help
Entry
420668            CDS       T01006                                 

Gene name
DYNC1LI1
Definition
(RefSeq) cytoplasmic dynein 1 light intermediate chain 1
  KO
K10416  dynein light intermediate chain 1, cytosolic
Organism
gga  Gallus gallus (chicken)
Pathway
gga04145  Phagosome
gga05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    420668 (DYNC1LI1)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05132 Salmonella infection
    420668 (DYNC1LI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    420668 (DYNC1LI1)
   03036 Chromosome and associated proteins [BR:gga03036]
    420668 (DYNC1LI1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    420668 (DYNC1LI1)
Membrane trafficking [BR:gga04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab4 associated proteins
    420668 (DYNC1LI1)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      420668 (DYNC1LI1)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     420668 (DYNC1LI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DLIC ABC_tran RsgA_GTPase Roc AAA_16 PduV-EutP
Motif
Other DBs
NCBI-GeneID: 420668
NCBI-ProteinID: NP_001161209
CGNC: 8732
Ensembl: ENSGALG00000011491
UniProt: Q90828
Position
2
AA seq 515 aa AA seqDB search
MAAVGRAGSFGSSSASGAANNASAELRAGGEEDDGQNLWSCILSEVSTRSRSKLPSGKSV
LLLGEDGAGKTSLIGKIQGIEEYKKGRGMEYLYLNVHDEDRDDQTRCNVRILDGDLYHKG
LLKFAMEANSLKDTLIMLVVDMSRPWTAMDSLQKWASVVREHIDKLKIPPEEMKEMEQKL
VRDFQEYVEPGEDFPASPQRRNTSLQEDKDDSVILPLGADTLTCNLGIPVVVVCTKCDAI
SVLEKEHDYRDEHFDFIQSHIRRFCLQYGAALIYTSVKENKNIDLVYKYIVQKLYGFPFN
VPAVVVEKDAVFIPAGWDNDKKIGILHENFQTLKAEDSFEDSIRKPPVRKFVHEKEIVAE
DDQVFLMKQQSQLAKQPPTAAGRPVDASPRVPGGSPRTPNRSVTSNVASVTPIPAGSKKI
DPNMKAGATSEGVLANFFNSLLSKKTGSPGGPGGVGGSPGGGSAGGTGSNLPPSAKKSGQ
KPVLTDVQAELDRISRKPEMVSPTSPTSPTEGEAS
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggggagagccggttccttcggttcctcctcggcatccggcgccgcgaac
aacgctagcgcggagctgcgggcgggcggcgaggaggacgatgggcagaacctctggtcc
tgcatcctcagcgaggtgtccacgcgctcccgctccaagctgccctcggggaagagcgtc
ctgctgctgggtgaggatggagcaggtaaaactagcttaataggaaaaattcaaggaatc
gaggaatacaaaaaaggaagaggcatggagtatttgtatttgaatgtgcatgatgaagat
cgagatgaccaaacgagatgcaatgtacggattttggatggtgacctgtatcacaaaggt
cttcttaaatttgcaatggaggcaaactcattaaaggacactctaattatgttggtagta
gacatgtcaaggccttggactgcaatggattctttgcaaaaatgggcaagtgttgtaaga
gaacacattgacaagttaaaaattcctcctgaagaaatgaaagaaatggagcaaaagttg
gtaagagacttccaggaatatgtagaaccaggcgaggatttcccagcttctccacagaga
agaaatacttcattacaggaagacaaagatgacagtgtgattttacccctgggtgcagat
acactaacatgtaacttaggcattccagtagtagtagtttgtacaaagtgcgatgccatc
agtgttctggaaaaagagcatgactacagagatgaacacttcgacttcattcagtcacat
atcagacggttttgcttacagtatggggctgcgcttatttacacttcggtaaaggagaac
aaaaacattgatttagtctataaatatatagtccagaagttgtacgggtttcctttcaat
gttccagctgttgttgtggaaaaagatgcagtatttattcctgcaggttgggataacgac
aagaagattggcatcttgcatgagaactttcaaacactaaaagcagaagacagttttgaa
gacagcataagaaaaccgccagtcagaaagtttgttcacgagaaagaaattgttgcagaa
gatgaccaagtgtttcttatgaagcagcagtcacaattggcgaagcaaccacctactgct
gcaggaaggccagtggatgcctcaccgagagttcctggaggatctcctaggacaccaaat
agatccgtaacatccaacgttgccagcgttacacctatccctgctgggtccaaaaaaatt
gatcccaacatgaaagctggagctaccagtgagggagtcctggcgaacttcttcaatagt
ctgttgagtaagaaaactggttcccctggtggccctggtggtgttggtggcagtcctggc
ggtggcagcgctggaggtactggcagcaatctaccaccatcagcaaaaaagtcaggtcag
aagccagttttaacagatgttcaggcagaattggacagaatttcacgaaagcctgaaatg
gtttctcctacatcacctacgtctcccacagaaggtgaagcatcttga

DBGET integrated database retrieval system