KEGG   Gallus gallus (chicken): 420696
Entry
420696            CDS       T01006                                 

Gene name
CCR2
Definition
(RefSeq) C-C chemokine receptor type 2
  KO
K04180  C-C chemokine receptor type 5
Organism
gga  Gallus gallus (chicken)
Pathway
gga04060  Cytokine-cytokine receptor interaction
gga04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    420696 (CCR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    420696 (CCR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:gga04030]
    420696 (CCR2)
   04050 Cytokine receptors [BR:gga04050]
    420696 (CCR2)
   04090 CD molecules [BR:gga04090]
    420696 (CCR2)
G protein-coupled receptors [BR:gga04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    420696 (CCR2)
Cytokine receptors [BR:gga04050]
 Chemokine receptors
  CC Chemokine
   420696 (CCR2)
CD molecules [BR:gga04090]
 Proteins
  420696 (CCR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx PspC
Other DBs
NCBI-GeneID: 420696
NCBI-ProteinID: NP_001039300
CGNC: 51320
Ensembl: ENSGALG00000011733
UniProt: Q702H7
Position
2
AA seq 354 aa
MENYTDLGDMPTTTFDYGDTAPCMGTEEKHFAANFLPPLYSLVVIFGFIGNILVVLILVK
YKKLKSMTDIYLLNLAISDLLFVFSLPFWAYYAAHDWIFGDALCRILSGVYLLGFYSGIF
FIILLTIDRYLAIVHAVFALKARTVTYGILTSIVTWAVALFASVPGIVFHKTQQENTQCT
CSFHYPSDALINWQHSYILKMNILGLIIPMIIMIFCYSQILRTLFGCRNEKKQKAVRLIF
VIMIFYFIFWTPFHVASFVHTFQTSFFSPDCDSQSRLEKTIQVTETISMVHCCINPVIYA
FVGEKFRKYLHMFFRKHVATHLCKKCPSLYREKLERVSSTFTASTAEHDISTGL
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggagaactatactgacttgggtgacatgccaacaacaacgtttgactacggtgataca
gcaccatgcatgggaactgaggaaaagcactttgcagcaaattttctgcccccactttac
tctttggtggtgatatttggcttcataggcaacattcttgttgtccttatcctggtaaaa
tacaagaagttgaagagtatgactgacatctacctgctcaatctggccatttctgatttg
ctgtttgtattttctcttcctttttgggcttattatgctgcccatgactggatttttgga
gatgcgctgtgccggattctctcaggtgtctacctccttggcttctacagtggcatcttt
ttcataatcctgttgaccatagacaggtatctggccatagttcacgcagtgtttgcttta
aaagctaggacagttacctacggcatcctcaccagcattgtcacgtgggctgttgctctt
tttgcctctgttccggggatagtatttcacaaaactcaacaggaaaatacacagtgtaca
tgcagttttcattatccttcagatgccctcataaactggcagcactcctacattctaaag
atgaacatccttgggcttatcattccaatgatcattatgattttctgttactctcaaatt
ttaagaacattatttggatgtaggaatgagaaaaaacagaaggcggttcgacttattttt
gtcatcatgattttttacttcatcttctggacacctttccatgttgcttctttcgtgcat
acatttcaaacttcttttttttccccagactgtgacagccaaagcagactggagaaaaca
attcaagtgacagaaacaatttcaatggtccattgctgtatcaatcctgtgatctatgca
ttcgttggagaaaaatttaggaaatatcttcacatgtttttccgaaagcatgttgcaact
cacctgtgcaaaaagtgtccatctctttatcgtgaaaaattagaaagagttagttccaca
ttcacagcatctactgctgagcacgacatctctactggactgtaa

DBGET integrated database retrieval system