KEGG   Gallus gallus (chicken): 420702Help
Entry
420702            CDS       T01006                                 

Gene name
LARS2
Definition
(RefSeq) probable leucine--tRNA ligase, mitochondrial isoform X1
  KO
K01869  leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    420702 (LARS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gga01007]
    420702 (LARS2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gga03016]
    420702 (LARS2)
   03029 Mitochondrial biogenesis [BR:gga03029]
    420702 (LARS2)
Enzymes [BR:gga01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.4  leucine---tRNA ligase
     420702 (LARS2)
Amino acid related enzymes [BR:gga01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   420702 (LARS2)
Transfer RNA biogenesis [BR:gga03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    420702 (LARS2)
 Prokaryotic type
    420702 (LARS2)
Mitochondrial biogenesis [BR:gga03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    420702 (LARS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1 tRNA-synt_1g Anticodon_1 tRNA-synt_1_2 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-GeneID: 420702
NCBI-ProteinID: XP_025003267
CGNC: 9002
Ensembl: ENSGALG00000036309
Position
2
AA seq 911 aa AA seqDB search
MDTVALRMQSVCRRFGACSTCLNRQLNGFVGLRNWTPLPSHACIRTIYSETGRWEKNYGQ
ETRRRVENWWFPRIKEQFCRISETDKSRPKFYVLSMFPYPSGKLHMGHVRVYTISDTVAR
FQKMRGMQVLNPMGWDAFGLPAENAAIEHGLHPASWTQSNIQHMREQFDALGLSFTWERE
ITTCLPEYYKWTQYLFLKLFESGMVYQKEALVNWDPVDQTVLANEQVDDNGCSWRSGAKV
EQKYLKQWFIKTTAYAKAMFDALSDLPEWYGIKEMQANWIGDCVGCSLDFLLKVNGEVTG
EKLAAYTYTPEAVYGASHLYILPSHRLLHGNSSLKEVFQREFIPGKDSLTSVTAVNLLTN
QEIPVVISGKTSFENYLDTKIGIPCTSAEDAAVAKNLNISFTEVIEKLPNGLEKVINSEE
FTGMTRQDALKALTQQAKNKGIGGDLMSDKLRDWLISRQRYWGTPIPVIHCQTCGTVPVP
YEDLPVVLPNVTTFTGKGASPLETVPEWVNCACPRCKAEARREIDTMDTFVDSAWYYLRY
TDPHNTDRPFNCDLADYWMPVDLYIGGKEHAVMHLFYARFFSHFCHDLKMTKHKEPFHKL
LVQGLIKNQTFRLRTTGQYLKREEIDLTGTEPVHLKSGEKVQVTWEKMSKSKHNGIDPEE
LMKEYGIDTIRLYILFAAPPEQDILWDTKTDAMPGVQRWQTRLWTLVTKLIEARTSETMP
NPEVLSKKQKAEARRIWEQKNLVISEVTEYFTKDHLFNAAISRLMSLSNVLHQASWPLVL
HSAEYEDALATLCIMVAPMAPHIASEMWKGLAHIENKLCTHHNWSADVLHQSWPKVDPEY
LQPPDVVEMSVLINNKACGKVFVPQQAARNFAEVHELVLQSELGAKHLQGRTIKKAFLSP
RTALINFLVQE
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atggacaccgtagcactgagaatgcagtcggtttgtcggagatttggtgcctgttccaca
tgtttgaacagacaactgaatggcttcgtgggacttaggaactggactcctctgccatct
catgcttgtatcagaactatttacagcgagacggggagatgggagaaaaactatgggcag
gaaacaaggagaagagtggaaaactggtggttcccaagaataaaggagcagttctgcaga
atttcagaaacagataaatcaagaccaaaattttatgtgctttctatgttcccatatccc
tctggaaaacttcacatgggtcatgttcgtgtctacaccatcagtgatactgttgctcgg
ttccagaagatgagagggatgcaggtgctaaatccaatgggatgggacgcatttggttta
ccagcagaaaatgcagcaattgagcatggtcttcaccctgcaagctggacacaaagtaat
attcaacacatgagggaacagtttgatgcactaggtctgtctttcacttgggaaagggaa
ataaccacttgtttaccagagtactacaaatggacgcaatacctcttccttaagcttttt
gagtctgggatggtgtatcaaaaagaggccttggtcaattgggatccagtagatcaaact
gttctagctaatgaacaggtggatgacaatggttgctcatggcgttcaggagcaaaagtg
gaacagaagtacctcaaacaatggtttatcaaaactactgcgtatgcaaaggctatgttt
gatgctttgtctgacctcccagaatggtatggtataaaagaaatgcaagcaaattggata
ggtgactgtgttggatgctcccttgacttcttgctgaaggttaatggtgaagtaacagga
gagaagttggctgcttacacctacactcctgaagccgtttatggagcttcccatttatat
atcttaccaagtcatagactgctgcatggaaatagcagtctgaaggaagtctttcagagg
gagttcatcccagggaaagactcactcacgtctgtgacggctgtgaacttgcttaccaat
caagagatccctgtagtaatctcaggaaaaacaagttttgagaactatcttgatacaaaa
ataggaattccttgtactagtgcagaagatgctgcagtagcaaagaatttgaacatttct
ttcactgaagtcattgaaaaactgccaaatggtttggagaaagtcattaattctgaggag
ttcacaggcatgactcgacaagatgctttaaaagctcttacccagcaggccaaaaataaa
ggaataggtggagacctgatgagtgacaaattaagggactggttaatatctcgacagcgg
tactggggaacacctattcctgttatccactgccaaacatgtggcactgttccggtgcct
tatgaagacttacctgtggtgctgcccaatgtaaccacttttacagggaagggagcctca
cctttagaaactgttccagaatgggtgaattgtgcttgtccaagatgtaaggcagaagct
aggcgagaaattgataccatggatacatttgtggattctgcttggtattacctgagatac
acagatcctcacaacactgacaggccctttaattgtgacttggctgactactggatgcct
gtggatttgtacattggaggcaaggagcacgcagttatgcacttattctatgctaggttt
ttcagccatttttgccatgatctaaagatgaccaaacacaaggagcctttccataagctt
ttggttcaaggtcttatcaagaatcagacgttcagactaagaacaacaggccagtatttg
aagagagaggagattgatctcactggcactgaaccagttcacctaaaaagtggtgagaaa
gtccaagtcacttgggaaaaaatgagcaaatctaagcacaatggaatagatcctgaagaa
ctaatgaaagagtatggcatcgacaccatacgtctttacattctgtttgctgctcctcca
gaacaagatattttatgggatactaagactgatgctatgccaggtgttcagagatggcag
actcgcctctggacacttgtaaccaaacttatcgaggcaaggacttcggaaaccatgccc
aatcctgaggttctgagtaagaaacagaaggctgaagccagaaggatctgggagcaaaag
aatcttgtaatttctgaggtaacagagtacttcacaaaggatcatttgttcaatgcagct
atttctcgcctgatgagcctttctaacgtactccatcaagcttcttggcctcttgttctt
cacagtgcagaatatgaagatgctttggctacactctgcattatggttgcacctatggct
ccacacatcgcatcagagatgtggaaaggtttggcgcatatagagaataaactttgtact
catcataactggagtgctgatgtgctgcatcagtcctggcccaaagtagacccagaatac
cttcaaccaccagacgtagtggagatgtctgttctgatcaataacaaagcctgcggcaaa
gtttttgtgcctcagcaagcagcccgcaattttgcagaagtccacgagctagttcttcaa
agtgaacttggagccaagcatctccagggacgcaccattaaaaaggcctttctgtctcca
agaactgcccttatcaacttcttagtgcaagagtaa

DBGET integrated database retrieval system