KEGG   Gallus gallus (chicken): 420705
Entry
420705            CDS       T01006                                 

Gene name
ZDHHC3
Definition
(RefSeq) palmitoyltransferase ZDHHC3 isoform X1
  KO
K20029  palmitoyltransferase ZDHHC3/7/25 [EC:2.3.1.225]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gga04131]
    420705 (ZDHHC3)
Enzymes [BR:gga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     420705 (ZDHHC3)
Membrane trafficking [BR:gga04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    420705 (ZDHHC3)
SSDB
Motif
Pfam: DHHC DUF3615
Other DBs
NCBI-GeneID: 420705
NCBI-ProteinID: XP_015137223
CGNC: 9011
Ensembl: ENSGALG00000029266
Position
2
AA seq 324 aa
MMISSVHRFRDIERTPEYLQPEKCVPPPSHASLGTMWFIRDGCGIACAVVTWMLVFYADF
VVLLVMLVPSRDYVYSVINGTLFNTLAFLALASHFRAMLTDPGAVPKGNATKEFIESLQL
KPGQVVYKCPKCCSIKPDRAHHCSVCKRCIRKMDHHCPWVNNCVGENNQKYFVLFTMYIA
LISLHALIMVGFHFLYCFEEDWTKCSSFSPPTTVILLILLCFEALLFLIFTSVMFGTQVH
SICTDETGIERLKKQKPTWERTSGWEGMKAAFGGTLSLSWLNPFSNLDCSSPPPTPPAPA
AAIMTQEEIEQFLAQEVSIQVPHE
NT seq 975 nt   +upstreamnt  +downstreamnt
atgatgatttcttcagtccaccgcttcagagatattgaaaggacacccgaatacctccag
ccggagaagtgtgttccacctcctagccacgcttccttgggaacaatgtggtttattcga
gatggctgtggtatcgcgtgtgccgtcgtcacctggatgctggtgttctacgctgacttt
gtagtccttcttgtcatgctagttccctcaagagattacgtttatagtgtcatcaatggc
acgctgttcaacaccttggcgttcctcgctttggcttcacattttcgtgctatgctgaca
gatccaggtgctgtgcccaaaggtaacgcaacaaaagagttcattgagagtttacagcta
aagccaggacaggtggtttacaagtgcccaaaatgttgtagcatcaaacctgacagagca
catcactgcagcgtttgcaagaggtgtatccggaaaatggaccatcactgcccatgggtc
aataactgcgtaggagagaataaccagaagtacttcgtactgtttacaatgtatatagca
ctgatttccctgcatgctctaattatggtgggatttcacttcttgtattgctttgaagaa
gactggacaaaatgcagctccttctctccaccaaccacagtgatccttctcatcctcttg
tgttttgaggctcttctctttctcatcttcacctcggttatgtttgggacccaagtacac
tccatctgcactgatgaaacgggcatcgagcgcctcaagaagcagaagccgacctgggag
cggaccagcggctgggaggggatgaaggcggccttcggcggtaccctgtccctgtcctgg
ctcaaccccttctccaacctggactgcagcagcccaccgccaacccctcccgcccccgca
gctgccatcatgacacaggaggagatcgagcagttcctggctcaggaggtgtccatccaa
gtgccccacgagtag

DBGET integrated database retrieval system