KEGG   Gallus gallus (chicken): 420745
Entry
420745            CDS       T01006                                 

Gene name
BBS9
Definition
(RefSeq) protein PTHB1 isoform X3
  KO
K19398  Bardet-Biedl syndrome 9 protein
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    420745 (BBS9)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   BBSome complex
    420745 (BBS9)
SSDB
Motif
Pfam: PHTB1_N PHTB1_C BBS2_Mid DUF166
Other DBs
NCBI-GeneID: 420745
NCBI-ProteinID: XP_015137158
CGNC: 9252
Ensembl: ENSGALG00000031650
Position
2
AA seq 888 aa
MSLFKARDWWSTVLGEKEEFDQGCLCVADVDNSGQDKIIVGSYMGYLRIFNPRPVKPGDG
VQAEDLLLEVQLREPVLQVEVGKFVSGTEGLHLAVLHCRRLCVYAVSETLGNVDHGNQYQ
IKLMYEHHLQRTACNMTYGPFGGVKGRDLICIQSMDGMLMLFEQESYAFGRFLPGFLLPG
PLTYSSRTDSFITVSSSRQVESYKYQVLAFATDADGRQETVQQKLSSGKKLVVDWVLNIG
EQALDICIVSFNQAVSSVFVLGERSLFCLKDNGQIRFMKKLDYSPSCFIPYCSVKEGTIN
TLVGNHSKMLYVYQDITLKWATQLPHVPVSVKVANLQGLKGVIVTLSDNGHLQCSYLGTD
PSLFQAPRVESKEINYEEFNAEMKELQKIIKEATITQDILPQSEKHRDLIVTAEVSPDLD
VESQAIDSEVKAEVVPSVTIKVTIQSKMTAQQPYLAVCIQAPLAVTCDRFTFNDLEPGSS
ETVVLSVFLKGNFPPSELEGNCVFSCNTPTELNPEGIPKVAQCKFKLPLRLVCFPAQPSK
SANHKLTIDTNKPPISFLTIFPDFADPSEEDQANVLGFQFLTGSKITLLASKTSQRYRIQ
SDQLEDLWLITKELTLRLEEHFKKQNCKDFACTFSGSVPLQEYFELIDRHFELRLNAEKF
QELLSERAIQFRAIERRLLTRFKDKTPAPLQHLDTLLEGTFREVIALADAAEENQANMFQ
AFTKLKSATHLVIMLISLWQKLNADQVAIMEATFLPLAEDTQELGWEETVDSAISFLLRT
CLSKSSKEQALSLSSQLSMPKDTSRLKKNISLFCDRLAKGGRLSLSTEAATQQATVVPGG
CATIPESDLEERAVVPGSTAVFSSHKHTAKQKSSPGLSEDAAEEAEKP
NT seq 2667 nt   +upstreamnt  +downstreamnt
atgtcattgtttaaagctcgagactggtggtccactgtacttggggagaaggaagaattt
gatcaaggctgtctgtgtgttgctgatgttgataatagtggccaagataaaattattgtg
ggcagttatatgggatatctccgtatctttaatccgcgtcctgtgaaacctggagatgga
gtgcaagctgaggacttgctcttggaagtgcagttacgagaaccagtactacaggtggaa
gtgggaaaatttgtttctggtactgaaggacttcatctggcagtgttgcattgccgaaga
ctctgtgtgtatgctgtttcagaaactctggggaatgtggaccatggtaaccagtatcag
atcaaactgatgtatgagcaccatcttcagcgaactgcttgtaatatgacttatggacca
tttggtggtgtaaaaggtcgagatttgatatgcatacagtccatggatgggatgctaatg
ttatttgaacaggaaagttatgcttttggccgttttttacctggttttctcctgcctggt
cccttgacttacagctctcggacagattccttcattacagtgtcttcctctcgacaggtt
gagagttacaaataccaagtgctggcatttgcaacagatgctgatggaagacaagaaaca
gtacaacaaaaacttagttctggaaagaaacttgtggtggattgggttctcaacattgga
gaacaagcactagatatatgcattgtctcctttaatcaggcagtttcttctgtttttgta
cttggtgagagaagtctcttctgcctaaaggataatggacaaattcgcttcatgaaaaag
cttgattacagtccaagttgcttcattccttattgttcagtgaaagaaggaacgataaac
actctagttggaaaccatagtaaaatgctgtatgtttatcaagatattacactgaaatgg
gccactcagcttccccatgttcctgtatcagtaaaagtagccaatttacaaggtctgaag
ggtgtcatagttactctgagtgacaatggacatctgcagtgttcctaccttggtactgat
ccttcactcttccaggctcctagggttgagtctaaggaaataaactatgaagaattcaat
gctgaaatgaaggagcttcagaaaatcatcaaggaagccacaataacacaagatattttg
ccccagtctgaaaagcacagagatctaattgtcactgcagaagtttcaccggacttggat
gtggagtctcaagccattgacagtgaagtaaaagcagaggtagtaccgtcagtcacaata
aaggtaacaatacagagcaaaatgactgcacagcaaccatacctggcagtatgcatccaa
gctccattagcagtgacctgtgaccggttcacctttaatgatttagaaccaggatcatct
gaaactgtggtcctgtctgtcttcttgaagggaaattttcctccatcggaactagaagga
aattgtgtgttttcatgtaatacaccaacagagctcaatcctgaagggataccaaaagtt
gcccagtgtaaattcaagctgcctttgcgattagtttgctttccagcacaaccttcaaaa
tcagcaaaccacaagctaaccattgataccaataaacctcccatcagctttctcaccatt
tttccagactttgccgatccatctgaggaagaccaggcaaatgttctgggatttcagttc
ttaacgggttcaaaaatcactcttcttgcttcaaaaacatcacaacgatacaggatccag
agtgatcaattagaagacctttggctaataacaaaggaattaacacttcgactggaagaa
catttcaaaaagcaaaattgcaaagactttgcatgtaccttttctggttcagttcctctg
caagaatactttgaactaattgatcggcattttgagctacgcttgaatgctgaaaaattt
caggagctgttatctgaaagggccatacaattcagagctattgagcgacgattgctgaca
cgatttaaagataaaactcctgctcctcttcaacatctggacaccttgctagaaggaacg
ttcagagaggtaatagctctagcagatgcagcagaagaaaatcaagccaacatgttccag
gcattcacaaagttgaaaagtgccacccatcttgtgattatgctgatcagcctgtggcag
aaactcaacgctgatcaagttgctattatggaagctacatttttgccattagcagaagat
acacaagagctgggttgggaagaaacagtggattctgctatttctttcttgctaagaaca
tgcttgtcaaagagctctaaggaacaagccctgtctcttagcagccagttaagcatgccc
aaagatactagcagacttaagaagaatatcagcctattctgtgatagattggcgaaaggt
ggtcgcctttctttaagcaccgaagcagccactcagcaagccactgttgtgccaggtggc
tgtgctacaatcccagagtctgacttggaggaacgagcagttgtaccgggctccacagca
gtgttctccagtcataagcacactgcaaagcagaaatccagccctggtttgtctgaggat
gcagcagaggaagcagaaaagccatga

DBGET integrated database retrieval system