KEGG   Gallus gallus (chicken): 420763
Entry
420763            CDS       T01006                                 

Gene name
POU6F2
Definition
(RefSeq) POU domain, class 6, transcription factor 2
  KO
K09368  POU domain transcription factor, class 6
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    420763 (POU6F2)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   POU domain factors
    420763 (POU6F2)
SSDB
Motif
Pfam: Pou Homeodomain Homeobox_KN HOCHOB FtsX_ECD CLN3
Other DBs
NCBI-GeneID: 420763
NCBI-ProteinID: XP_418861
CGNC: 9347
Ensembl: ENSGALG00000031713
Position
2
AA seq 673 aa
MIAGQVSKPLLSLRSEMNAELRGEDKAATSDNELNEPLLAPVESNDSEDTPSKLFEARGN
TVLSDTSPGDQHQPSQSHPAFPVGPQPLLTAQQLASAVAGVMPGGTPALNQPILIPFNMA
GQLGGQQGLVLTLPTANLTNIQGLVAAAAAGGIMTLPLQNLQATSSLNSQLQQLQHLQQL
QHQQQQQQQQGQQQQQQSQQQQQQTQQTQTPQPSQQTQQPQPQPQPSAPPQQNQTQPQSQ
SQQPSVPQSSSSPQKPSQSPGHGLPSPLTSPNPLQLVNNPLASQAAAAAAAAAMGSIASS
QAFGNALSSLQGVTGQLVTNAQGQIIGTIPLMPNPVPSSQAAGGAQGLQVQPITPQLLTN
AQGQIIATVIGNQILPVINTQGITLSPLKPGQQLHQPSQTQVGQAASQPNLLHLAHSQAS
MSQSPVRQASSSSSSSSSSSALSVGQLVSNPQTATGEVDGVNLEEIREFAKAFKIRRLSL
GLTQTQVGQALSATEGPAYSQSAICRHTILRSHFFLPQEAQENTIASSLTAKLNPGLLYP
ARFEKLDITPKSAQKIKPVLERWMAEAEARHRAGMQNLTEFIGSEPSKKRKRRTSFTPQA
LEILNAHFEKNTHPSGQEMTEIAEKLNYDREVVRVWFCNKRQALKNTIKRLKQHEPATAV
PMEPLTDSLEENS
NT seq 2022 nt   +upstreamnt  +downstreamnt
atgatagctggacaagtcagtaagcccttgctgtcactgcggagtgaaatgaatgcagag
ttgagaggtgaggacaaggcagctacttcagacaacgagctgaatgagcccctgcttgcg
cctgtggaatcaaatgacagcgaggacactcccagcaagctcttcgaggccagaggaaac
acagtgctgtctgatacaagcccaggtgaccagcaccaacccagtcagtcccatcctgca
ttccctgttgggcctcagccattactgacagcccaacagttagcctcagcggtagcaggg
gtgatgccaggaggcactccggccctgaatcaaccgattcttattcctttcaacatggct
gggcagctgggaggccaacaaggattggtcctaactctacctacagcaaatctcaccaac
atccaaggactggtagcagcagctgcagcaggaggcattatgactttgccattgcaaaat
ctacaagctacctcatccctgaactctcagcttcaacagcttcagcatcttcagcagctc
cagcaccaacagcagcagcagcagcagcaagggcagcagcagcagcagcaaagccagcag
cagcagcagcaaactcagcagacacagactccacagccatcccagcagacccagcagcca
cagccacaaccacagccatcagcacctccacagcagaaccaaacacagccccagagccag
agtcagcagccttcggtcccacagtcctccagttcccctcagaaaccaagccagtcacca
gggcatggccttccatctcctcttacttcaccaaatccattgcagctggttaacaatcca
ctagcaagtcaagcagcagcggctgcagcagcagcagccatgggctcaatagcaagctcc
caggcctttggcaatgccctctccagtcttcagggggtcacaggtcaactcgtcactaat
gcacaaggacagattattggaacaatcccactgatgcctaatccagtcccctccagccag
gcagcaggtggagctcagggccttcaggtgcagccaataactccacagttattgaccaat
gcccagggtcagatcatcgctaccgtcatcggcaaccagatactccccgtgatcaatacc
cagggaataacgctatcgccactcaaaccaggccaacagctccatcagccctcccagacg
caagtgggacaagcagcctcacagcccaatctcctgcatttggctcacagtcaagcatct
atgtctcaaagcccagttcgtcaggcttcctcttcttcctcctcatcctcctcttcttca
gctttgagtgttggccagttagtcagcaatcctcaaacagccactggagaagtggatggg
gtgaatctggaagaaatccgagaatttgccaaagcttttaaaatccggcgcctgtccctt
ggcctcacccagactcaagttggccaagccctaagcgctactgaaggcccagcctatagc
cagtctgccatctgcagacacaccatcctgagaagccactttttcctaccacaggaagcc
caagagaacactatagctagcagtctgacagccaaactgaaccctggccttttgtatcct
gccaggtttgaaaagctggacatcacccctaaaagtgcccagaagataaagccggtgctt
gagcggtggatggctgaggctgaggcccgccatcgagcaggtatgcagaaccttaccgag
tttatcggaagtgaaccatccaaaaagcgcaagaggcgtacctcattcacgccacaagcc
cttgagatcttgaatgctcactttgagaagaacacacacccctctgggcaggaaatgaca
gagattgcagagaaactgaactatgaccgggaagtagttagagtttggttctgcaataag
aggcaagcactgaagaacacaattaaacgtttgaaacagcatgagcctgcgacagcagtt
cctatggagcccttaacagactcactggaagaaaactcctaa

DBGET integrated database retrieval system