KEGG   Gallus gallus (chicken): 420808Help
Entry
420808            CDS       T01006                                 

Definition
(RefSeq) uncharacterized protein LOC420808
Organism
gga  Gallus gallus (chicken)
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 IlvN GFO_IDH_MocA AlaDh_PNT_C F420_oxidored
Motif
Other DBs
NCBI-GeneID: 420808
NCBI-ProteinID: XP_004935138
CGNC: 51344
Ensembl: ENSGALG00000039617
Position
2
AA seq 328 aa AA seqDB search
MKGEELPGLLVNEIGGMHGILHDHVEFLKKHFCLITMKEFLENKKNMSKKVQAVYLWWHK
PVIDKDLLQSLPNLKVIANSGVGMDHLDLKLVASFGVKMANAPCAVSSSTADTGMALLLA
SARRLVEGYHVAVSPGMEYCEADFLGVEVTGATLGIIGMGSIGYKIALRAKAFEMKILYH
NRTRRKEQEEQAVGALYCEKIDDLLCQADFVMVVVSLTPQTHKLIGKREMELMKPTATLI
NISRGAVVDQEALVIALRSGVIRAAALDVTYPEPLPRDHPLLKLKNVIITPHLGIKTDKA
TRMITEEAVENILAALAGLPMPSEVHPS
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaagggagaagagctgcctgggcttttggtaaatgaaattggaggaatgcatgggata
ctgcatgaccatgtggagttcctgaagaagcatttctgcctcatcactatgaaggaattt
cttgaaaacaaaaagaatatgagtaaaaaggtccaagcagtctatctgtggtggcacaaa
ccagtcattgacaaagacctcctccagagcctgccaaacttgaaagtgattgcaaattca
ggagtaggaatggatcatctggatctgaaacttgtagctagctttggtgtgaaaatggct
aatgctccatgtgctgtttccagtagcacagcagatactgggatggctttgctgctggca
tctgctagaagactagtagaaggctatcatgttgctgtttccccgggtatggagtactgc
gaagctgattttcttggagttgaagttactggagctactctggggatcattggcatgggc
agcattgggtataagattgctctgagagccaaagcgtttgaaatgaagattttgtaccat
aacagaacacggaggaaagagcaggaagagcaagctgttggtgccctttactgtgaaaag
atagatgatttgctctgccaggcagatttcgtgatggtggtggtgagcctgacacctcag
acacacaagctgattgggaaaagagagatggaactgatgaaacccacagctactctcatt
aacataagccgaggtgcagtggtggaccaagaggcgttggtgatagctctgcgcagtggt
gttatcagggctgcagctttggatgtcacctacccagagccactgcccagagatcatcca
ttattaaaattgaagaatgtaattataacacctcaccttggcattaaaacagacaaggct
acccgcatgataacagaggaagcagttgaaaacatattagcagctcttgctggtcttccc
atgcctagtgaagtgcaccctagctga

DBGET integrated database retrieval system