KEGG   Gallus gallus (chicken): 420815
Entry
420815            CDS       T01006                                 

Gene name
NFATC1
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 1 isoform X9
  KO
K04446  nuclear factor of activated T-cells, cytoplasmic 1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04218  Cellular senescence
gga04310  Wnt signaling pathway
gga04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    420815 (NFATC1)
   04310 Wnt signaling pathway
    420815 (NFATC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    420815 (NFATC1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    420815 (NFATC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    420815 (NFATC1)
Transcription factors [BR:gga03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    420815 (NFATC1)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 420815
NCBI-ProteinID: XP_004935153
CGNC: 9602
Ensembl: ENSGALG00000042534
Position
2
AA seq 482 aa
MHLHGYLESEPLTLQLFIGTADDRLLRPHAFYQVHRITGKTVSTTSHETILSNTKVLEIP
LLPENNMRATIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQSNGRTLSLQV
ASNPIECSQRSAQELPLVEKQSTDSFPVTGGKKMILTGHNFLQDSKVIFLEKAPDGHHVW
EMEAKTDKEMCKPNSLVVEIPPFRNQRITSPVQVNFYVCNGKRKRSQYQIFTYLPANVPI
IKTEPTDDYEPAQTCGPMNQGLSPLSKPYYNQQIMMPPDPGSCLMAGFASCQQRNAVMSP
SPNASPKLHDLSSSPYKCIPNPGHSHLGLQQPAGGVPTIQEVPRSIVVHPSSPEQSSHIM
LQPQVSQHLSSSCPLGYQQTLYPNSPSSPVPSVTQEPTYLQSCSPTHSSIMGQQQQQLPK
VHRNESPTTQPLSLPELHEESNHNLAPIPVTIKREPEELDQMYLDDVNEIIRNDLSSTNV
HS
NT seq 1449 nt   +upstreamnt  +downstreamnt
atgcatctacatggttacttagaaagcgagcctctcacgctacagctgttcattgggact
gcagacgaccgcctgctgcgaccccatgctttctaccaggttcatcgaatcactgggaag
actgtttccaccaccagccacgaaacaatactttccaacaccaaagtcttggaaatccca
cttcttccagagaacaacatgagagcaaccattgactgtgctgggatattaaagctcaga
aactctgacatcgaactgcggaagggagaaacagacatcgggaggaagaacacacgtgtg
cgactggtcttccgagttcacatcccacagtccaacgggaggaccctctctttgcaagta
gcctccaaccctatcgagtgctctcagagatctgcccaagaactgcctctggtggagaaa
caaagtaccgacagctttcctgttactggagggaaaaagatgattctgactggccataac
tttctgcaagactcgaaagtcatctttttggagaaagcaccagatggtcaccatgtgtgg
gaaatggaagccaaaactgacaaagaaatgtgcaagccaaattcattggtggttgagata
ccacctttccgcaatcagagaattaccagccctgttcaggtcaacttctatgtctgcaat
ggaaagagaaagagaagccagtaccagattttcacctatcttcctgctaatgttccaatt
ataaaaacagaacccacagatgactatgagcctgctcaaacctgtggaccaatgaaccaa
ggcttaagccctctctctaaaccgtactacaaccagcagatcatgatgccccctgatcct
ggttcgtgtctcatggctggcttcgcctcctgtcagcagaggaacgcggtgatgtcaccc
tctcccaacgcaagccccaagctgcatgacctttcatcctctccttacaagtgcatcccc
aacccaggccacagtcacctcggacttcagcagcccgctggaggtgtccccaccatacag
gaagtgccaaggtctatagttgtgcacccaagctcccccgagcaatcatctcacatcatg
ctgcagccgcaggtgagtcaacatctgagcagtagctgtccccttggttatcaacaaaca
ctctatcccaacagtccctcttctccagttccatctgttacccaagagccaacctatttg
cagtcctgcagtccaactcactcatccataatgggtcaacagcagcagcaactgccgaag
gttcacagaaatgagtctccaacaacccaaccactgtcattgccagagttgcatgaggaa
agtaatcataatttggcccctattcctgtaacgatcaagcgagaacctgaggaattggac
cagatgtacctggatgatgtaaacgaaatcataaggaatgacctttccagtaccaatgtc
cattcatag

DBGET integrated database retrieval system