KEGG   Gallus gallus (chicken): 420868
Entry
420868            CDS       T01006                                 
Symbol
BMP6
Name
(RefSeq) bone morphogenetic protein 6
  KO
K16620  bone morphogenetic protein 6
Organism
gga  Gallus gallus (chicken)
Pathway
gga04060  Cytokine-cytokine receptor interaction
gga04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    420868 (BMP6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    420868 (BMP6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gga04052]
    420868 (BMP6)
Cytokines and growth factors [BR:gga04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   420868 (BMP6)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta YafO_toxin
Other DBs
NCBI-GeneID: 420868
NCBI-ProteinID: XP_015131483
CGNC: 9693
Position
2:complement(64375767..64462773)
AA seq 427 aa
MPRRLAWLCCCWALLSGACRPAEPPPPAAAPGFLYRRLKSHEKREMQREILSVLGLPHRP
RPPPREPPAPPPGRLPAAPRFMLDLYHALAEGAEGAAGAERGGRPQPPAPLPPVPSAQDS
AFLNDADMVMSFVNLVEYDKEFTPHQQHHKEFKFNLSQIPEGEAVTAAEFRIYKDCVVES
FKNQTFLISIYQVLQEHPNRASDLFLLDTRAVWASEEGWLEFDVTATSNMWVMNPQHNMG
LQLSVVTHDGFSVNPREAGLIGRDGPYDKQPFMVAFFKVSEVHVRTTRSAASRRRQQNRN
RSTQAQDVSRVSTVTDYNSSDLKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECS
FPLNAHMNATNHAIVQTLVHLMNPDYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMV
VRACGCH
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgccgcggcggctggcctggctgtgctgctgctgggcgctgctgagcggcgcctgccgc
cccgccgagccgccgccgcccgccgccgccccgggcttcctctaccggcggctgaagtcg
cacgagaagcgggagatgcagcgggagatcctctccgtgctggggctgccgcaccgtcct
cgcccgccgccgcgggaaccgccggcgccgccgccgggacggctgccggcggcgccgcgc
ttcatgctggacctgtaccacgcgctggccgagggcgcggagggagccgcgggcgcggag
aggggcggccgcccgcagccccccgccccgctgccgccggtgcccagcgcgcaggacagc
gccttcctcaacgacgccgacatggtgatgagcttcgtcaacctggttgagtacgacaag
gagttcacccctcaccagcagcaccacaaggagttcaagttcaatttgtctcagattccc
gagggcgaggctgtcacagctgctgagtttcggatctacaaggactgcgtggtggagagc
tttaaaaaccaaacttttcttatcagcatctaccaagtgctgcaggaacatccaaacaga
gcctctgacctgtttctgctggatacgcgggcggtatgggcttcggaggagggctggttg
gagtttgatgtcactgccaccagtaacatgtgggtgatgaatcctcagcacaacatggga
ctccagctgagcgtggtgacccacgacggtttcagtgtaaatcctagagaagcaggcctt
atagggcgagatggcccttacgacaagcagcctttcatggtggcattcttcaaagtgagc
gaagtccacgtgcggactacgaggtcagcggcaagcaggcgcaggcagcaaaatcgaaac
cgctccactcaggctcaggatgtttccagggtgtcaactgtcacagattacaacagcagt
gacttaaaaaccgcgtgcagaaagcatgaactttacgttagcttccaagacttgggatgg
caggactggataatcgctccaaagggctatgcagccaactactgtgatggggagtgctcc
tttccactcaatgcacatatgaacgcaaccaaccacgccatcgtccaaactctggttcat
cttatgaatcctgattacgttcccaaaccatgctgtgcacctaccaaactaaatgccata
tcagttctttatttcgatgataattctaatgtaatcttgaagaaatacaggaatatggta
gtaagagcctgtggatgtcactga

DBGET integrated database retrieval system