KEGG   Gallus gallus (chicken): 420911
Entry
420911            CDS       T01006                                 

Gene name
DROSHA
Definition
(RefSeq) ribonuclease 3
  KO
K03685  ribonuclease III [EC:3.1.26.3]
Organism
gga  Gallus gallus (chicken)
Pathway
gga03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    420911 (DROSHA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:gga03019]
    420911 (DROSHA)
   03009 Ribosome biogenesis [BR:gga03009]
    420911 (DROSHA)
   03036 Chromosome and associated proteins [BR:gga03036]
    420911 (DROSHA)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.3  ribonuclease III
     420911 (DROSHA)
Messenger RNA biogenesis [BR:gga03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     420911 (DROSHA)
Ribosome biogenesis [BR:gga03009]
 Eukaryotic type
  90S particles
   RNase
    420911 (DROSHA)
 Prokaryotic type
  rRNA processing factors
   420911 (DROSHA)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Microprocessor complex
     420911 (DROSHA)
SSDB
Motif
Pfam: Ribonucleas_3_3 Ribonuclease_3 dsrm
Other DBs
NCBI-GeneID: 420911
NCBI-ProteinID: NP_001006379
CGNC: 9781
Ensembl: ENSGALG00000012916
UniProt: Q5ZIR3
Position
2
AA seq 1336 aa
MSFHSGRGCPRGQGGPGARTSAQTYRPQNLRQLHPQQPSVQYQYDQQAAPAATYSNPSAT
SYMPPRPDFVPYPPPVPPSTQNPINQCPMRPPFPNHQMRQSFPVPPCFPPAPPPVPAPSN
APVPATATGQSTFPYMMPPPAVPHPPPPPVIPQQVNYQPVYSTGYSQQSFPPPNFNSYQH
NSSSFQSSTTNSSSGSSHFRHTGQYQGEKSQSDRRSPERSKHYDEHRHREHSHIHGDRHR
SNNHGDRRDRGRSPDRRRQESSRHRTEYDRGRMSPHHRSYERSRERDRDRHRHRDSRRSP
SPDRSYKKDYKRAGSRSPSRERKRPRWEEERERWSESQSANKEKNYTSIKDKESEENASE
KNEDEDDELLKPVWVRCTHSESYYSNDPMDQVGDSTVVGTSKLRDLYEKFEEELGKRQAK
AKAARPPWEPPKTKLDEDLESSSESECDSDDDSSCSSSSDSEVFDVIAEIKRKKAHPDRL
HEELWYNDPGQMNDGPLCKCSAKARRTGIRHGIYPGEEPIKPCRPMTNNAGRLYHYRITV
SPPTNFLTDRPTVIEYDDHEYIFEGFSMFSHAPLTNIPLCKVIRFNIDYTIHFIEEMMPE
NFCVKGLELFSSYLFKDILELYDWHLKGPSVENDSVSCPRFHFMPRFVRFLPDGGKEVLS
MHQILLYLLRCNKALVPEEEIANMLQWEELEWQKYAEECKGMIVTSPGMKPSSVRIDQLD
REQFNPDVITFPIIVHFGIRPAQLSYAGDPQYQKLWKSYVKLRHLLANSPKVKQADKQKL
SQREEALQKIRQKNTMRREVTVELSSQGFWKTGIRSDVCQHAMMLPVLTHHIRYHQCLMH
LDKLIGYTFRDRCLLQLAMTHPSHHLNFGMNPDHARNSLSNCGIRQPKYGDRKVHHMHMR
KKGINTLINIMSRLGQDDPAPSRINHNERLEFLGDAVVEFLTSVHLYYLFPTLEEGGLAT
YRTAIVQNQHLAMLAKKLELDRFMLYAHGPDLCRESDLRHAMANCFEALIGAVYLEGSLE
EAKQLFGRLLFNDKDLRDVWLNYPLHPLQLQESNTDRQLIETSPVLQKLTEFEEAIGVIF
THVRLLARAFTLRTVGFNHLTLGHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLR
SSLVNNRTQAKVAEELGMQEFAITNDKTKRPVALRTKTLADLLESFIAALYIDKDLEYVH
TFMNVCFFPRLKEFILNQDWNDPKSQLQQCCLTLRTEGKEPDIPLYKTLQTVGPSHARTY
TVAVYFKGERIGCGKGPSIQQAEMGAAMDALEKYNFPQMAHQKRFIERKYRQELKEMRWE
REHQERETDETEEARK
NT seq 4011 nt   +upstreamnt  +downstreamnt
atgtctttccattctggacgaggatgtccccgtgggcaggggggaccaggagcaagaact
tcagcacagacgtatcgtcctcagaacctgcggcagcttcacccccagcagccttctgta
cagtaccagtatgaccagcaagccgcacctgcagctacctattcaaacccttcagccacc
agttacatgcctcccaggccagactttgttccatatcccccaccagttcccccttccaca
caaaatcccatcaaccagtgtcccatgaggccaccgtttccaaaccatcagatgaggcag
agcttcccagtgcctccatgcttccctcctgctcctccaccagtgccagcccctagcaat
gctcccgtgccagcaactgctactgggcagagtacctttccatacatgatgcctcctccc
gcagtaccccatcctcccccaccaccagtcataccacagcaagtcaactaccagcctgta
tattccacagggtattcccagcagtcattcccaccacctaacttcaatagctatcagcac
aactctagctcctttcagagcagcactaccaatagcagcagtggcagcagccattttcgg
cacacgggtcagtaccagggagaaaagtcacaaagtgatcgacgatctccggagaggagc
aaacactacgacgagcaccggcaccgtgagcacagtcacatccacggtgacaggcatcga
tccaataaccacggggatcgtcgggatcgaggccgcagtccagacaggaggaggcaggaa
agcagtcggcaccggactgaatatgacagaggaagaatgtcgcctcatcatagaagttat
gagcgtagcagggagcgtgacagggataggcataggcaccgtgacagcagaagatcacca
tcaccggacaggtcctacaaaaaagattataaaagagcaggaagccgctctccaagtaga
gaaagaaagagaccccgatgggaggaggaaagagaaaggtggtctgagagccagagtgcc
aacaaagaaaaaaactacactagtatcaaagacaaagagtcagaggagaatgcatctgaa
aaaaatgaagatgaagatgatgaattacttaaaccagtctgggttcgctgtacccattct
gaaagctattattcaaatgaccccatggatcaagtgggggactctactgtggtaggcaca
agcaagctccgagatctgtatgagaagtttgaggaggagctaggaaaacgacaggcaaag
gccaaagcagccaggccaccatgggagccgccgaagaccaagctggatgaagatcttgag
agctccagtgagtcagaatgcgactctgatgatgacagcagctgctccagcagttcagat
tcggaagtttttgatgtcattgcagaaattaagcgtaagaaagcacaccctgatcgtctt
catgaggaactgtggtacaatgatccaggacagatgaatgatggaccgctgtgcaagtgc
agcgctaaagcccgacgaacagggataagacatggcatttatcctggtgaagagcccatt
aaaccatgtcgccccatgaccaacaatgctggaagactgtaccattatcgaattacagtg
tcacctcccacaaacttcttaacagacagacctactgttattgagtatgatgaccatgaa
tatatcttcgaaggattctccatgttttcacatgccccactgacaaacattcctctatgt
aaagtaatcagatttaacattgactatacaattcatttcattgaagagatgatgcctgag
aatttttgtgtgaaaggtcttgagctgttctcttcttatctattcaaagatattctggag
ctgtatgactggcatcttaaaggtccttcagttgaaaatgattctgtttcctgccccaga
tttcacttcatgccgcgatttgtgagatttcttccagatggagggaaggaagtactgtca
atgcatcagattcttctctacttgttacgatgcaataaagctttggtgcctgaagaagag
attgccaacatgcttcagtgggaagagctggaatggcagaaatatgcagaggaatgcaaa
gggatgatcgttaccagccctggcatgaaacccagctcagttcgtattgatcaactggac
cgtgaacaattcaatcctgatgtaattactttccccattattgtccactttgggatacga
cctgctcaactcagctacgctggagatcctcaataccaaaaactatggaagagttatgtg
aagctgcgtcacctgctagctaacagtcccaaagtcaaacaagctgataaacagaaatta
tcacagagagaggaagcactgcagaaaatccggcagaagaacacgatgagacgtgaagtg
actgtcgagttgagtagccagggattctggaagacggggatacgctctgatgtctgccag
cacgcaatgatgcttcctgtcctcacccaccatattcgctaccatcagtgtctgatgcat
ttggacaagttgataggctacacttttcgagataggtgcctgctgcagcttgccatgact
catccgagccatcacttaaactttggaatgaatccagaccatgccagaaattccttatcc
aactgtgggattcgacagccaaagtatggggacagaaaagttcaccatatgcatatgaga
aaaaaagggataaacaccctgataaatattatgtcccgtttgggacaggatgatccagct
ccttccaggattaaccacaatgagcgtttagaatttctgggagatgctgtggtggagttc
ttaacaagtgtccacttgtactacctgtttcccactctggaggaaggaggattagctacg
taccgcactgccatagttcagaaccagcatctggccatgctggctaagaagctggaacta
gatcgatttatgctttatgctcatggtccggacctttgcagggaatcggatctccgccat
gccatggccaactgctttgaagcactaataggagcagtttatctggagggtagtcttgaa
gaagccaaacaattatttggacggttgctcttcaatgacaaggacctgcgggatgtatgg
cttaattatccactacacccactccaactgcaggagtctaatactgacaggcaactcatt
gagacctctccagttcttcaaaagcttacggagtttgaggaggcaattggagtcatcttt
actcatgttcgacttctagcacgtgcattcactctgaggacagtaggctttaaccacctg
actctaggccacaatcagaggatggaattcctgggtgactccataatgcagttggtagcc
acagagtatttattcatacatttccccgatcatcatgaagggcacttaacgctgttgaga
agctctctggtgaacaacaggactcaggccaaagtggcagaagagctgggaatgcaagag
tttgccatcactaatgacaagaccaaaagacccgtagctcttcgaactaaaactctggca
gatctcttggaatcctttattgctgccctgtacattgataaagatttggaatatgttcac
actttcatgaatgtatgcttttttccacgactaaaggaattcattttaaatcaagattgg
aatgaccctaaatctcagcttcagcagtgctgcttgactctcaggacagaaggaaaggag
ccagacattcctctttacaagactctgcagacagtgggaccatctcatgccaggacgtac
actgtagctgtttatttcaaaggggaaagaataggatgtggtaaaggcccaagtattcaa
caagcagaaatgggagctgcaatggatgcacttgaaaaatataactttccccagatggcc
catcagaaacggttcattgaacggaagtacagacaagagttgaaagaaatgaggtgggaa
agagagcatcaagagagagaaacagatgagactgaagaagcaaggaaataa

DBGET integrated database retrieval system