KEGG   Gallus gallus (chicken): 420946
Entry
420946            CDS       T01006                                 

Gene name
FIGNL1
Definition
(RefSeq) fidgetin-like protein 1
  KO
K22766  fidgetin-like protein 1 [EC:3.6.4.-]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    420946 (FIGNL1)
   03400 DNA repair and recombination proteins [BR:gga03400]
    420946 (FIGNL1)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     420946 (FIGNL1)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    420946 (FIGNL1)
DNA repair and recombination proteins [BR:gga03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     420946 (FIGNL1)
SSDB
Motif
Pfam: AAA AAA_lid_3 Vps4_C RuvB_N AAA_16 AAA_5 AAA_2 AAA_22 TIP49 Mg_chelatase
Other DBs
NCBI-GeneID: 420946
NCBI-ProteinID: XP_001234039
CGNC: 15845
UniProt: A0A3Q2U8Z9
Position
2
AA seq 688 aa
MEAPTHGTVHLSDWQKSYFAIASGTCTPGQKADEYRAKILRIQYAWANSEISQVCAANLF
KKYAEKYSAIIDSDNIETGLNNYAENILTLAKCQQNDSDKWQSALTTENVFGLKCVQERM
QAGKKIQSSQTAPADALVLADKGVSASAAPCLPGLSAFSSTGESERCAGSSKCAGRGPHL
LEHPLSSKSLQSNVPPVTKTSDILPASSASLSEQIHAGFPAAPLFGNKEMTSGASLKIPG
NCSDGQNLSLPSQSAVQAWSGKRKAFYGLTDKGSTATSSLAPYQASSTTEANSFSGSRNG
SEESGVPGFRTAKEQLWVDQQKKPQSLQQRAPVSSYGGVKKSLGAGRSRGPFSKFVPPVP
KQDGNENGGVQCKPHARGPTEPLFPVDERLKSIEPKMVELIMHEIMDHGPPVNWDDIAGV
EFAKATIKEIVVWPMLRPDIFTGLRGPPKGILLFGPPGTGKTLIGKCIACQSGATFFSIS
ASSLTSKWVGEGEKMVRALFAVARCQQPAVIFIDEIDSLLSQRGDGEHESSRRIKTEFLV
QLDGATTSSEDRILVVGATNRPQEIDEAARRRLVKRLYIPLPEASARKQIVTRLMSKEHS
CLSEEEIELIVKQSDGFSGADMTQLCREASLGPIRSLQSMDITTIMPEQVRPIAFVDFES
AFGTVRPSVSSKDLELYETWNWTFGCGR
NT seq 2067 nt   +upstreamnt  +downstreamnt
atggaggccccgacgcatggcaccgtgcacctgagcgactggcagaaaagttactttgct
attgcctctggcacctgcacacccgggcagaaggctgatgagtaccgtgccaaaattctg
cgtattcagtatgcatgggcaaactctgagatctctcaggtctgtgctgccaacctcttt
aaaaaatacgcagagaaatactctgcaattattgactctgacaacatagagactggcttg
aataactatgctgaaaacattttgactttggcaaagtgtcagcaaaatgacagtgacaag
tggcaatctgccttgacaacagagaatgtatttggattgaagtgtgtgcaagagaggatg
caggctggcaaaaagatccagagctctcagacggcaccagcagatgcccttgtactagct
gataaaggggtcagtgcctctgctgctccatgccttcctgggctcagtgctttcagcagc
accggtgagagtgaacgctgtgctggctcatcaaaatgtgcaggtcggggcccacatctc
cttgagcatcccttgtcttcaaagtctctccaaagcaatgtgcctcctgtgaccaaaact
tcggatatacttcctgcatcttctgcctccttaagcgaacagattcatgcagggttcccg
gcagcaccgctgtttggaaataaagaaatgacaagtggtgcttctctgaaaattccaggt
aactgtagtgatggacagaatttgtctcttcccagtcagtcagctgtacaagcatggtct
gggaaaagaaaagcattttatggcttgactgataaaggcagcactgccacttctagcctt
gctccgtaccaggcttccagtactactgaagccaacagtttttcagggagtagaaatgga
agcgaagagagcggtgttcctggttttagaactgcaaaagaacagctgtgggtggatcag
caaaagaaacctcaaagcctacagcaacgtgcgccagtctcatcatacggaggcgtaaaa
aagtcactgggtgctggtagatctcggggtccatttagcaagtttgttcctccagtccca
aaacaggatggaaatgaaaatggaggagtgcagtgtaaacctcatgccagagggccgaca
gaacctttatttcctgtagatgaacgactgaaaagtatagaaccaaaaatggtggaactc
attatgcatgaaatcatggaccatgggcctcctgtgaactgggatgacattgctggagtt
gaatttgctaaagctacaataaaagaaattgtagtctggcctatgctgaggccagacatc
tttactgggttacgtggtcctcctaaaggaattcttctctttggcccccctggaactggc
aagactctaataggcaaatgcattgcttgccagtctggagctactttttttagcatcagt
gcctcttctctgacttccaaatgggtaggcgagggggaaaagatggtccgtgcgctgttt
gctgtggcacgatgtcaacagccagcagtgattttcattgatgaaattgattctctgttg
tctcagcggggggatggggagcatgagtcttcaaggagaataaaaaccgaatttttggtc
cagttagatggggcaacaacctcctctgaagatcgtattctggtggttggtgcaacgaat
cgaccccaggaaattgatgaggctgcccgaaggagactagtgaagagactttacattcct
cttccagaagcttcagctaggaagcagattgttactcgtctgatgtcaaaggagcacagc
tgtctcagtgaagaggaaattgagcttatagttaagcaatcggatgggttttctggggca
gacatgacacagctgtgtcgtgaagcttctctgggccctatccgcagtcttcagtccatg
gatatcacaaccatcatgccagagcaagtacgacccattgcttttgttgactttgagagt
gcctttggaaccgtgcggcctagcgtgtcctcaaaggacctggagctgtatgaaacctgg
aactggacatttggctgcggcagatag

DBGET integrated database retrieval system