KEGG   Gallus gallus (chicken): 420947Help
Entry
420947            CDS       T01006                                 

Gene name
DDC
Definition
(RefSeq) aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00350  Tyrosine metabolism
gga00360  Phenylalanine metabolism
gga00380  Tryptophan metabolism
gga01100  Metabolic pathways
Module
gga_M00037  Melatonin biosynthesis, tryptophan => serotonin => melatonin
gga_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    420947 (DDC)
   00360 Phenylalanine metabolism
    420947 (DDC)
   00380 Tryptophan metabolism
    420947 (DDC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    420947 (DDC)
Enzymes [BR:gga01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     420947 (DDC)
    4.1.1.105  L-tryptophan decarboxylase
     420947 (DDC)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   420947 (DDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 420947
NCBI-ProteinID: XP_004935201
CGNC: 9900
Ensembl: ENSGALG00000013094
UniProt: E1BV90
Position
2
AA seq 485 aa AA seqDB search
MDATEFRKRGKEMVDYVADYLEKIEKRQVFPDVEPGYLRTLIPDCAPQDPESFEDVFKDI
EKIIMPGVTHWHSPYFFAYFPSASSFPALLADMLCGGIGCVGFSWAASPACTELETVMLD
WLGKMISLPEEFLAGRDGQGGGVIQGSASEATLVALLAARTKTIRRVRSEKPELTEADIM
GRLVAYASDQAHSSVERAALISGVKMKSVPSDDTFAVHGSALKKILDEDKASGLIPFFFC
ATLGTTPCCSFDKLLELGPICNKENIWMHIDAAYAGSAFICPEFRHFLNGVEFADSFNFN
PHKWLLVNFDCSAMWVKKRSDLIGAFKLEPLYLQHHHQESGLITDYRHWQIPLGRRFRSL
KLWFVLRMYGVTGLQEHIRKHVRLSHQFEHLVLQDERFEICAEVVLGLVCFRLKGSNELN
KALLKSINEAKKIHLVPCHLREKFVLRFAICSRTVESTHVKFAWQHISQLATELLKTWEQ
NHQQQ
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggatgctacagagttccgcaagagggggaaggagatggtggactacgttgcagattac
ctggagaagatagaaaaaagacaggtcttcccagatgtggaaccaggatacctgaggacc
ctcattccagactgtgcaccacaggatcctgagagctttgaggatgtctttaaagacatt
gagaagatcattatgccaggggtgactcactggcacagtccctacttttttgcctacttc
ccgtcagccagttccttcccagctctccttgcagacatgttatgtggtggaataggatgt
gtgggcttctcttgggctgcaagtccagcttgcacggagctggagactgtcatgctagat
tggctagggaagatgattagcctgcctgaggagttcttagctggaagggatgggcaaggc
ggaggagtcattcagggaagtgcaagcgaggccacccttgttgcactgctggctgcaaga
acaaaaaccatcaggcgggtgcggtcagagaagcctgagttaactgaggcagatatcatg
ggcaggctggtggcctatgcttctgatcaggctcattcatccgtggaaagggctgcactg
atcagcggtgtgaagatgaaaagtgttccttcagatgatacatttgcagttcatggttca
gccctaaagaaaattttggatgaagacaaagcttctggtcttatcccattctttttttgt
gcaacgcttggaaccacaccttgctgctcctttgacaaactgctagaactgggtcctatt
tgtaataaggaaaatatctggatgcatattgatgcagcctatgctgggagtgcattcatc
tgtcctgaattcaggcattttttaaatggagtggagtttgcagattcatttaactttaat
ccccacaaatggctcctagtgaattttgactgctctgctatgtgggtgaaaaaaagatca
gatttaattggtgcttttaaattagagcctctctacctgcagcatcaccaccaggagtct
ggcctcataacagattaccggcactggcagatccccctggggaggaggttccgctccctg
aagctctggtttgtgctgaggatgtatggggtcacgggtctgcaggaacacatccgcaag
catgtcaggctgtcgcaccagtttgaacatttagtccttcaggatgaaagatttgagatc
tgcgctgaggttgtcttgggactagtctgctttcgactgaagggctcaaatgaactaaat
aaggcacttcttaaaagcataaatgaggccaagaagattcatctggtcccatgccacctg
cgagaaaagtttgtgctacgctttgctatttgttcccgcacggtggaatccacccacgtc
aagtttgcctggcagcacatctcacagctggcgaccgagctcctgaaaacatgggaacaa
aaccaccagcagcagtaa

DBGET integrated database retrieval system