KEGG   Gallus gallus (chicken): 420949Help
Entry
420949            CDS       T01006                                 

Gene name
COBL
Definition
(RefSeq) protein cordon-bleu isoform X1
  KO
K18623  protein cordon-bleu
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    420949 (COBL)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     420949 (COBL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cobl WH2 RBD Rad60-SLD
Motif
Other DBs
NCBI-GeneID: 420949
NCBI-ProteinID: XP_004935203
CGNC: 9906
Ensembl: ENSGALG00000013102
UniProt: A0A1D5PAR9
Position
2
AA seq 1412 aa AA seqDB search
METLVRPTAGKPPSGRRMKARAPPPPNQPSATSRIHSEHKSPAETAVISDQSLVSMKENM
INRMVDFTVILPSGVEQKSTVQGSKAVMDLLVDLCSRYHLNPSQYSLELKSLETQQPLSY
KPNTLIGALDVQTVLLKEKVPEEKIKRPLPRAPEKSVRLVVNYLKTQKAVVRVSPDVPLH
NIIPAICEKCEVSQEHIVLLRDSITGEELELTKSLEELGISELYAWDRKRVPPSKTQSDP
SLNYREPSRSVSLSNDAIEKEKKGFLGFFKANRSNSKTEEHLRMNRDYGEEDVFSSTSTS
EGSLDGFSTAPNSPSVNSRSSTLGPSLSLGNISGMTANPEVKKRRAPPPPVLTPPLQNME
MSSAQEKTAVQISQGASLNDLQKKKRRAPLPPTQSAPPTPAMPNRREEMEDKRKSTMGDG
RQVPQKPPRGPTRDPPQLVIPPPPPYPPPERDNMDPAVSYREADVTAPTKLVPKQSLLPA
HDNFYVVDDTVMELSEVEETASESSCFASEDTTEDSGVVSSPSDIVSLDSQNDSMKLRDI
KLVNGYVDSDTIYGAETCSVKNAYCDDMGYAGTPQSTKNEEMAAAKHENEDIFIDAQLQQ
TLADLDEDLEAMDVLSNSDSEHMSEVLSPHSGKVEVPQDVASSVPVTVIDDAPEVTIYNS
AGNQETRGSQNLSADSVNMGNFTNRNNNAGSFDKGHTDGGAVCIPKDLIHQQPSDNEFSH
IPVEQRRDMFESLTSSFEKRSEKNVRVEAPPRHVMKSEECKSKLTSSHSKTATEINTAKE
KVNPFNECSKRERPLKKSKSELEIKRPPAKKIEVEEVPSTPPWCHRAQKLETSYEPKMGL
TTFKVVPPKPEVKNFDRGLSVSTGAIKIDELGNLINPKPVVSKNIPGTSAGESEEIPLGK
VKAFWRSSSMEKQSDDSAEHLAKKPAVTTNSKSFVTKQECKPVCLAAPKPVPPQTVISQV
GEKQSENEKTKPPLPVTQSQVKPLVVPAINKDKPELPFLKPHRRTSSQYVASAIAKHINL
PTFKTDSTDLHEKDENKHGAGEVKTEAEVSPKRCIIVAKYSPVETESAETREKISSIFTC
SQKASHRFTPGDNSGMENKVVNIRAPSQATPASFYKKNASVPLTKSSSKDNNKAEDDHSL
NSKQGTAEKKMHLLFDQKYETLPRSNSASSLKSPDLQGASSSFSSSLRITKWPPADSVQV
SSLKASPEFSGVTAKAESEQNDKSDDSAANAIGELDVNVQTNIFGPKKKFKPVVQKPIPK
DTSLHSALMEAIQTGGGKEKLRKVSDSALNGNHKKPSYSEPENERSALLAAIRGHSGTCK
LKKISSLASEELQSFRNAELSSQKAEDPQEEQLCIPPAPAQPPPPPPPQLSTATFKFSAT
TTGDPGEARRALMEAIRSGAGAAKLKKVPLLV
NT seq 4239 nt NT seq  +upstreamnt  +downstreamnt
atggagactctcgtccgccccacggccggcaagccgcccagcgggagaagaatgaaagct
cgtgctcctcctccaccaaaccaaccttctgcaaccagtagaattcacagtgagcacaag
tcacctgcagagacagccgtaatttctgatcagagccttgtgagcatgaaggagaatatg
ataaatagaatggtggacttcacagtcattttacccagcggggtggaacagaagagcaca
gtacaaggaagtaaagctgtgatggatcttttggttgatctatgcagccggtatcacttg
aatccatcccagtacagtcttgaattgaagtctttggaaactcaacaacctttgagttac
aagccaaacactttgataggagcactggacgtacagacagtactcctgaaagagaaggtt
cctgaagagaagatcaagagacctctgccgagggctcctgagaagtctgtgaggctggtg
gtaaattacctgaagacacagaaggcagtggttcgagtcagcccggacgtgccccttcac
aacatcatcccagctatttgtgaaaagtgtgaggtcagtcaggagcacattgttcttctg
cgagacagcatcactggcgaggagctggagcttaccaaatccttggaggagctgggaata
agcgagctgtacgcctgggaccgaaaaagagttcctccatcaaaaactcagtctgaccct
tctctgaactacagagaaccaagtcgaagtgtttcactaagcaacgatgcaatagaaaaa
gaaaagaaaggatttctggggtttttcaaagctaatagaagcaacagcaagacagaagaa
cacttgaggatgaacagagattatggtgaggaggatgtttttagttctacatctacaagt
gaaggaagcttggatggtttttccacagcaccaaactccccttcggtgaattcccgttcc
agtaccttgggtccatcgctgtcccttggtaatatctcaggaatgacagcaaacccagaa
gtgaaaaagcgcagagcacctcctccaccagttttgacacctccgttgcagaatatggag
atgagctccgctcaggagaagacagcagtacagatttcacaaggagcatctcttaacgat
ctacagaaaaagaagaggcgtgcacctcttccaccaactcagtctgctccacctactcca
gccatgccaaataggagggaagagatggaagacaagaggaagagcacaatgggtgatgga
cggcaggtgccacaaaagcctcctaggggccccactcgtgacccaccccagttagtgatc
cccccacccccaccttaccctcctcctgaaagagacaatatggatccagcagtctcttac
agagaagcagatgttacagcaccaacaaaactggtacctaaacagagcctgctgcctgca
catgataatttttatgtagtggatgatacagttatggagctatcagaggtagaagaaaca
gcgtcagaaagcagctgctttgcatctgaggacactaccgaagactcaggtgtagtgagc
tccccatctgacattgtgtcactggattcacaaaatgacagtatgaagttgagagacatc
aagctggtgaatggctatgtggactcagacacgatctatggtgcagagacttgctctgtg
aagaacgcgtactgcgatgatatgggatatgccggtactccacagagcactaaaaatgaa
gaaatggctgcggctaagcatgagaatgaggacatattcattgatgcacaactccagcag
actttggctgacctggatgaagatttagaagctatggatgttttaagtaactctgactct
gagcacatgagtgaagtgttgagcccacattcaggaaaagttgaggtcccccaagatgtt
gctagttctgttccagtaacagtcatagatgatgctccagaagttaccatctataactca
gctggaaaccaagagacaaggggttcacagaatctatcagctgactctgttaatatggga
aacttcacaaatagaaacaacaatgcaggttcctttgataagggacacactgatggtgga
gctgtatgtatacccaaggacctaatacatcagcagccatctgataatgagttcagtcac
atacccgtggaacagaggagagatatgtttgaatctctcacgtcctcctttgaaaaaaga
agtgaaaagaatgtaagagtagaagctccgcccagacacgttatgaagtctgaggagtgt
aaatcgaagctgacgtcatctcactccaagactgcgactgaaatcaatacagcaaaagag
aaagtaaatccatttaatgaatgtagtaagagggagagacctctgaaaaaaagtaagtca
gaactagaaatcaaaaggccaccagcaaaaaagattgaagtagaagaagttccatcaaca
cctccgtggtgtcatcgtgcccagaaattggaaacaagttatgaacccaaaatgggtttg
acgaccttcaaagttgtccctcccaaacctgaagtaaaaaattttgatagagggctttca
gtctccactggtgctattaagattgatgaactaggcaaccttatcaacccaaagcctgtt
gtcagtaagaacataccaggtacctctgctggtgaaagtgaggaaattcctcttgggaaa
gtgaaggcattctggaggtcaagttctatggaaaaacaaagtgatgactctgctgagcat
cttgctaaaaagccagcagttaccacaaactctaagtcctttgttacaaagcaagaatgc
aaacctgtctgtcttgcagctccaaaacctgtaccaccacaaactgttatttcccaggta
ggtgaaaagcagtctgagaatgagaagaccaaaccacctcttccagttacacagtctcag
gtaaaaccattagtggtcccagccattaataaggacaagccggagcttccatttctaaag
cctcacagaagaacttccagtcagtatgtggcctctgccattgcaaaacacatcaatctg
cctacctttaagactgattctacagatttgcatgagaaagatgaaaataagcacggggca
ggagaggttaaaactgaagctgaagtttcccccaaaaggtgtattattgtggccaagtac
agccctgtggaaacagaatcagcagaaacaagagaaaaaatttcaagtatttttacttgt
agtcaaaaagcatcccacagattcacacctggtgataattctggcatggaaaacaaagta
gtgaacatcagggcaccgagtcaagcaactcctgctagtttctataaaaagaatgccagt
gtcccacttactaaatcctcttcaaaggataacaacaaagcagaagatgatcacagttta
aacagcaaacaaggtacagcagagaaaaagatgcatcttttgtttgaccagaaatacgag
actttgccccgtagtaattcagcctcctctctcaagtcacctgatctccaaggagcctca
tcttctttcagttcatctttgcgcatcactaaatggcctcctgctgacagcgtgcaagtt
agttccctgaaagcatcgcccgagttcagtggtgtgacagcaaaggcagaatcagaacag
aatgacaaatctgatgattcggctgctaatgctattggcgaattggatgttaatgtgcag
actaatatcttcggaccaaagaagaagttcaaacctgttgtccaaaaaccaattccgaaa
gatacatcactgcacagtgccctcatggaagctattcaaacaggagggggaaaagagaaa
ctcagaaaggtttcagacagcgcgctaaatggcaatcacaagaaaccatcatacagtgag
ccagagaatgagcggtcggccctactagcggcaattagaggccacagtggcacttgcaag
ctgaaaaaaatctcctcattggcctccgaagagctccagagttttaggaatgcagaactg
tcttcacagaaagcagaagaccctcaggaagagcagctctgcattccacctgcccctgcc
cagccaccaccaccgcctccccctcagctgtcaacagcaactttcaaattctctgccaca
actacgggtgaccctggagaggccaggcgagccctgatggaggccattcgctctggtgct
ggagcagcaaagttaaaaaaggtccctctgctcgtttga

DBGET integrated database retrieval system