KEGG   Gallus gallus (chicken): 420952
Entry
420952            CDS       T01006                                 

Gene name
FHOD3
Definition
(RefSeq) FH1/FH2 domain-containing protein 3 isoform X1
  KO
K23939   
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: FH2 Formin_GBD_N Drf_GBD
Other DBs
NCBI-GeneID: 420952
NCBI-ProteinID: XP_015137839
CGNC: 9916
Ensembl: ENSGALG00000013124
Position
2
AA seq 1598 aa
MATLVCRVQFLDDTDPFNSTNFPEPTRPPLYTFREDIPLGTQLAGVHRLLRAPQKLDDCT
LQLSHNGTYLDLESTLAEQRDELEGFQEDAGRGKKHSIILRTQLSVRVHACIEKLYNSNG
RELRRALFSLKQIFQDDKDLVHEFVIAEGLTCLIKVGAEADQNYQNYILRALGQIMLYVD
GMNGVINHNETIQWLYTLIGSKFRLVVKTALKLLLVFVEYTESNAPLLIQAVSTVDEKRG
AKPWSNIMEILEEKDGVDTELLVYAMTLVNKTLSGLPDQDSFYDVVDCLEELGIEAISQR
HLNKKGTDLDLVEQFNIYEMTLRHEDGDETADPPPSGRKDRRRASLGGSERRGLERRRSR
RHSVQNVKSTLSAPASPCSQSNPSFMLGHGQRVDDLSEREEEEYEEEEEEQPVTEPNTED
EGEEETSRQVKDSGVPGAQEAVKENFSQCCESSATSSAISQAERPLPCSRVKSSSSSTSF
VPDSSVSHHNSIISPPSSPAAVLLSSSQNSSASITPKASPTVEKLPYVPHTPFHLFSYDF
EESPASVKEKEAEVMRENRYNSYGSNSYSSPRPYSGLSAPTTPTSRYGTTLSPPQESKSD
RPALGGLLTSSFRQHQESLAAERERRRQEREERLQRIEREERNKFKYKYLERLAAEEYEK
ELKSRSVSRGRSELSLNLRSPSAPSSPVPKCVSPASIESQEELKTPSTPCGTPQHSEVSA
SEPEPETETEPEAEQETEAEPEQGTETPKEIEATEVGPESEVEQGPEREPEESAILSEKE
RQNEEVNEKDNCSASSISSASSTLEREEREDKLTSDNETGPWSQTIQDAGVNEQCSKILN
NKRFMLDMLYAHNKKPKDEEEKELEAKEEKKETEESEESLTSLASRISILQATKQAKDES
VKKMEIGNLDNQGSVKAFAEKFNSGELAKGTALPEDEISEQVPEKTPAQPKKESDYIWDQ
LMANPRELKIKDMDFTDLGEEDDVDVLDMDMGPGDSLVPPPPPPPSFLGLPPPPPPPLFG
CPPPPPPSANLLAPPPLFSTPQGLGSPQVSRGQPAFIKKKKTIRLFWNEVRPFEWQCKNN
KRCREFLWSKLEPIKVDTSKLEHLFESKSKELPVTKKTAADGKRQEIIVLDSKRSNAINI
GLTVLPPPRTIKTAILNFDEYALNKEGIEKILTMIPTEEEKQKIQEAQLANPDVPLGSAE
QFLLTLSSISELSARLQLWAFKMDYEIVEKEVAEPLLDLKEGMDQLEHNKTLGFILSTLL
AIGNFLNGTNAKAFELSYLEKVPEVKDTVHKQSLLHHVCTMVVEKFPDSTDLYSEIGAIT
RSAKVDFEQLQENLCQMERRCKASWDHLKAIAKHEMKPTLKQKMSEFLKDCAERIIILKI
VHRRIINRFHSFLLFMGHPPYAIREVNINKFCKIISEFALEYRTTRERVLQQKQKRANHR
ERNKTRGKMITDTDEEEDTESGKFSSTSPSSPVQPQGLQYAEDAAEHENMKAVLKTSSVS
GESTTTLGVRTRSRVSRGRIGSWNAGNDDSPNATDDAADEIMDRIVKSATQVPSQRAVPR
ERKRSRANRKSLRRTLKSGLTPEEAKALGLISTSEMQV
NT seq 4797 nt   +upstreamnt  +downstreamnt
atggccacgctggtgtgccgggtgcagttcctggatgacaccgaccccttcaacagcacc
aacttccccgagcccacccggccgccgctgtacaccttccgcgaggacatcccgctcggc
acgcagctggccggcgtgcatcgcctgctccgcgccccgcagaagcttgatgactgcact
ctgcaattgtctcacaatggtacctatctggacttagaatctactctagcagaacaaaga
gatgaattggagggcttccaggaagatgctgggaggggcaagaagcacagtataattttg
aggacccagctgtcagtgagagtccatgcctgtattgaaaaactttacaattccaatgga
cgggagctgagacgtgcacttttttcattgaagcaaatatttcaggatgacaaggacttg
gttcatgagttcgttatcgctgaaggcctgacttgcctaatcaaagtaggagcagaggca
gaccagaattatcagaactacatcctgagagccttgggccagattatgctctacgttgat
ggcatgaatggagtaataaaccataatgaaaccatccaatggctgtacacacttattggg
tcaaagttccgccttgtggtaaagacagcactgaagctgctgcttgtatttgtggagtac
actgaatccaatgcaccacttttaatccaagcagtatctacagttgatgaaaagagagga
gccaagccttggtccaacatcatggagatcctggaggagaaagatggggttgatactgaa
ctactggtttatgccatgactttggttaacaagacgctgtcggggttgccagatcaagac
tctttctacgatgtggtggactgtctcgaagagctgggcattgaagctatttcacagaga
cacttgaacaagaaaggaacagacttggacttagttgaacaatttaacatttatgagatg
accctgaggcacgaagatggcgatgagaccgctgacccccctcccagtgggcgcaaggac
agaagaagggccagtctgggtggcagtgagcgaaggggtctggagcgccgacggagccgc
aggcactcagtacagaacgtcaaaagcactttatcagctcccgccagtccatgcagtcag
tcaaaccccagcttcatgctaggccacggacagcgcgtggatgatctcagtgagagagag
gaggaggagtatgaagaagaggaagaagaacagccagtcacagaacccaatactgaggat
gagggggaggaagagaccagtaggcaggtcaaagacagtggggtcccaggtgcacaggaa
gctgtgaaagaaaacttttcacagtgttgtgaatcttcagccacctccagtgccatttct
caagctgagaggcctctcccctgctctagagtaaagagctcttctagcagcacctctttt
gtgcctgattcatctgtctctcatcataattctattatttcaccaccatcttcaccagca
gcagttttgctaagctcttcccaaaattcatcagcatccattactccaaaggcatctcca
acggtagagaaattgccttatgtaccacatactccttttcacctcttctcatatgacttt
gaagagtctccagcatctgtgaaagaaaaggaagcagaggtgatgagggaaaacagatac
aatagctatggcagcaactcttactcttctccgcgaccttactctggtttgagtgctcct
acaacacccacttctcgttatgggacaactctctcaccacctcaggagtccaagtctgac
aggcctgctttgggtggtcttcttacatcatctttccggcagcaccaggagtccttggca
gcagaaagagaaagacggcgccaagagagagaagaaaggttgcagaggatagaacgtgaa
gaaagaaacaaattcaaatacaaatacttggagagattggcagccgaggagtatgagaag
gagctgaagagtcgaagtgtaagccgaggcagaagtgagctgtccttgaacctgagatct
ccttcagccccatcctcacctgtacccaagtgcgtcagcccagcatccatagagtcccag
gaagagctgaagaccccctctaccccctgtggaactcctcagcactcagaagtgagtgcc
agtgaacctgaaccagaaacagagacagaaccagaagcagagcaggagactgaggcagag
cctgagcagggaacggagacacccaaggaaatagaggctacagaggtgggaccagagagt
gaggtggagcaaggaccagagagagagccagaagaaagtgcaatactcagtgaaaaagag
aggcagaatgaggaagtgaatgaaaaagacaactgctctgcatccagcatatcctcagca
agcagcactttagagagggaagagagagaggacaagttaaccagtgacaatgaaactggt
ccatggtcccagaccattcaggatgctggcgtgaatgagcagtgcagcaagatcctcaac
aacaagcggtttatgctggacatgctgtatgcgcataacaaaaagcccaaggatgaagag
gagaaggagctggaggcgaaggaggaaaagaaggagacggaggaaagcgaggagtccctc
actagtctagccagtaggatctctatccttcaggccacaaagcaggccaaagatgaaagt
gtcaaaaagatggagatcggaaacctggacaaccaaggcagcgtgaaagcctttgcggaa
aaattcaacagtggtgagctggccaaggggacagccttgcctgaagatgaaatcagtgaa
caggtccctgagaaaacaccagcacagccaaagaaggaatctgactacatctgggatcaa
ctcatggctaatcctagagaactgaaaatcaaagacatggattttacagacttgggggag
gaggatgatgtagatgtgttggacatggatatgggtcctggggactcccttgttccccct
cctccacctccaccttctttcctgggtttgcctcctccaccacctcccccactgtttgga
tgtcctcctccacctccaccctctgctaatttattggctcctcctccgctgttcagcact
cctcagggtttagggtcaccccaggtttctaggggtcagccagcatttataaagaagaag
aaaaccatccgtctgttttggaacgaggtacggccatttgagtggcagtgtaaaaacaac
aaacgctgcagagaattcctgtggtcgaaactggaacccattaaggtggacacttccaaa
ctggagcatctctttgagtcgaagtccaaggaactgcctgtcacaaagaaaactgctgca
gatgggaagcgacaggagatcattgtgttggactcaaaacgaagcaatgctattaatatt
ggcttgactgtgctaccccctccacggacgatcaagactgctattctgaattttgacgaa
tatgccttaaacaaggaaggaatagagaaaattttgaccatgatcccaactgaggaggag
aagcagaagatccaggaggcacagctggcgaaccctgatgtccccctgggcagtgctgaa
cagttccttctcaccctctcctccatcagtgaactctctgccaggctccagctctgggct
ttcaagatggactatgagatagtggaaaaggaagttgcagaaccacttctagacctgaag
gaaggaatggaccaactggagcacaataaaactttgggatttatcctttctactctacta
gccattgggaactttctcaacggaaccaatgccaaagcttttgagttgagctacctcgag
aaggttccagaagtaaaggacacagtgcataagcagtcccttctgcaccacgtctgcact
atggtggtggagaagttcccagacagcactgatctttattcagagattggggccatcact
aggtcagccaaggttgactttgaacaactccaggaaaacttgtgtcagatggaaagacgg
tgcaaagcatcttgggatcaccttaaagctatagcaaagcatgaaatgaagccaactcta
aaacaaaaaatgtctgagttcctcaaggactgtgcagaaagaatcataatcctgaagatt
gttcatagaagaataattaacaggtttcactcatttttgttatttatgggccatcctccc
tatgcgatacgtgaagtcaacatcaataagttctgcaaaattattagtgaatttgctctg
gaataccgcaccaccagggaacgagtcctgcagcaaaaacagaaacgagctaaccacagg
gaaagaaacaagaccagaggaaaaatgatcacagatactgatgaagaagaggacactgag
tccggaaagttctccagcacctcaccctcctccccagtccagccccagggcctacagtac
gccgaggatgccgcagagcacgagaacatgaaggctgtgctgaagacctcctctgtcagt
ggagagagcaccacgacgctgggggttcgcactcgcagccgggtcagccggggccgtatc
ggttcatggaatgctggcaatgatgattcacctaatgcaacggatgatgcagcagatgag
ataatggatcgcattgtaaagtccgccacccaagtgccaagccagcgagcggtgcctaga
gagaggaagcggtcacgagcaaataggaagtcattgagaaggacactaaagagcggactg
acaccagaagaagccaaagcattgggcctcatcagcacctctgagatgcaggtttga

DBGET integrated database retrieval system