KEGG   Gallus gallus (chicken): 420989
Entry
420989            CDS       T01006                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    420989 (AHRR)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    420989 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_11 PAS_3 PAS_9 Herpes_U5
Other DBs
NCBI-GeneID: 420989
NCBI-ProteinID: NP_001188316
CGNC: 51383
Ensembl: ENSGALG00000013402
UniProt: E5L8C8
Position
2
AA seq 756 aa
MIPPGECLYAGRKRRKPIQKQRPAAGNEKSNPSKRHRDRLNAELDHLASLLPFPPDIISK
LDKLSVLRLSVSYLRVKSFFQAIQEKHFKKQVGQTIKEDNVSNKTAVQEGGLLLESLNGF
ALVVSADGMIFYASSTIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMNPPQMSG
QQLQTETGEEYILSKLFKAQENDSTTTDYSSFLTRCFICRVRCLLDSTSGFLTMQFQGKL
KFLFGQRKKSSSGAVLPPQLSLFCIVVPLLLPSVTEMKMKSLLVKAKHKADDAAVNTNSS
TKSNSGLCEAAELYGRNCHHEGAAFANVLQITENQFKAKNNGENGISLVKVQTNEDHWVW
VQANTQLLYRSGCSEYVVAQQQMLKEEDEQLKIPNSFASLKGNLEGLSYNGAIETLGQLK
HLNWTAVKNEQDNVKVKFEPHTNGECFVQEESLTSNTPVLGIQNNCTTNNSWTFRNSSSC
SINQRMNACSNRRAGSFYNRDQSFLNLASTCPSHWGSAENCQSYSGLQQRAVENYTADHL
KLQRSLISSESLYDAAFPLDMPIKTEYDSDSENIADNYPMPQNRAWLDENGTMRKQLFSY
PNRVHLKAEPDLCQQASPCQKPRHCLYTPHNWQCIVANHPSNLNLNRSCKGLRNREVAPF
CPQNSSACLESLPDQPHTEGYGQFYSLAPGEKEQSNEVFKMPCEFKNPCLVQAIKREPLD
SPPLSNSGQNRAHMSFPENTIAGPVPHKATECTFLQ
NT seq 2271 nt   +upstreamnt  +downstreamnt
atgattcctccgggggaatgcctctatgctgggaggaaaaggaggaaacccattcagaaa
caaaggcctgcagctggaaatgaaaaatcaaacccttcaaagaggcacagggaccgccta
aatgcagaactagaccatctggccagcctcctgcctttcccacccgacataatatccaag
ctggacaagctgtctgtgctgcgccttagtgtcagctacctgcgagtcaaaagtttcttt
caagccattcaagaaaagcactttaagaagcaagttggtcagacaataaaagaagacaat
gtatctaacaagactgctgtccaagaaggtggacttctactagagtcactgaacggtttt
gcattggtagtgagtgcagatggaatgatattttatgcatcatcaacgattgtggactac
ctagggtttcatcagactgatgtaatgcaccaaaacatatacgattacattcatgttgat
gatcgccaggatttctgtagacaactgcactgggccatgaatccacctcagatgtctgga
cagcaactacagacagaaacaggagaagaatatattctcagtaaattgtttaaagcacaa
gagaatgacagcacaacaacagattattcttccttcttaactcgttgtttcatctgtcga
gttcgctgcttattggacagtacttctggcttccttacaatgcagtttcaaggcaaacta
aagtttctttttggacaaaggaagaagtcctcatcaggagcagtattaccacctcaactg
tccttattctgcatagtggtaccacttctactcccttctgtgacagagatgaagatgaaa
agcctgcttgtgaaagcaaaacacaaagctgatgatgcagcagtgaatacaaactccagt
accaaaagtaattcaggtctgtgtgaagcagcagaattatatggaagaaactgtcatcac
gaaggtgcagctttcgctaatgtattacagattactgagaaccaattcaaagcaaagaat
aatggagagaatggcatttctctagtcaaagtacaaacaaatgaagatcactgggtctgg
gttcaagctaacactcaacttctgtatcgaagtggttgttcagaatatgttgttgcccaa
cagcaaatgctgaaggaagaagatgaacaactgaagataccaaacagttttgccagtttg
aaaggaaacctggagggactttcctacaacggtgccattgaaaccctgggccaattgaag
catctcaactggacagctgttaaaaatgagcaagataacgtaaaagtgaagtttgagcct
catacaaatggtgagtgtttcgtgcaggaggaatcgctcacttctaatacaccagtttta
ggcattcaaaacaactgcaccacaaacaatagctggactttcagaaactcaagctcttgt
tctataaatcagcgaatgaatgcgtgttcaaacagaagagctggatcgttctacaacaga
gaccaaagtttcttaaatttagcatcaacttgtccttcccactggggtagtgcagaaaat
tgtcagtcttactcaggcttacaacaacgtgctgtggagaactatactgcagaccacctg
aaactgcagagatcgttaatatcctcagagtctctctatgatgcagcgtttcccttggat
atgcctatcaaaacagaatacgattctgattctgaaaacattgctgataactacccgatg
ccacaaaaccgtgcctggctggatgagaacggcaccatgaggaagcagttgttcagctat
cccaatagggtgcaccttaaagcagaaccggacctctgtcagcaagcttcaccttgccag
aagccaaggcactgcctttacacgccacataactggcagtgcattgtagcaaatcatccc
agcaacctcaatctgaacagatcttgcaagggtttgcgtaacagagaggtggccccgttt
tgcccccagaactcctctgcctgcttggaaagcctgcctgaccagccgcacaccgagggc
tacggccagttctacagccttgctccaggggagaaggagcagagtaacgaggtgtttaaa
atgccgtgtgaatttaaaaacccttgcttggttcaggcaatcaagcgtgagcccctggat
tccccaccgttgtccaacagtggacagaacagagcacacatgagcttccctgaaaataca
atagcaggtcctgtgcctcataaagccactgaatgtacattcttacaatag

DBGET integrated database retrieval system