KEGG   Gallus gallus (chicken): 420999
Entry
420999            CDS       T01006                                 

Gene name
GLIPR2
Definition
(RefSeq) Golgi-associated plant pathogenesis-related protein 1 isoform X1
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: CAP
Other DBs
NCBI-GeneID: 420999
NCBI-ProteinID: XP_004935245
CGNC: 10184
Ensembl: ENSGALG00000028821
Position
2
AA seq 168 aa
MSTRKLAASNYYDSAIKNSSKQFAEEVLKAHNDYRKKHGVPPLKLCKKLNRGAQQYAEEL
AASRILKHSSESASGKCGENLAWASYDQPGKDVADRWYSEIKNYSFQNPGFSSGTGHFTA
MVWKSTKKMGVGKASASDGSTFVVARYDPAGNVVNPGYYEENVLPPRK
NT seq 507 nt   +upstreamnt  +downstreamnt
atgtctactcgcaaacttgctgctagtaattattatgattctgcgataaaaaactcttcc
aaacaatttgctgaagaggtcttgaaagcacacaatgactacaggaagaaacacggagtc
ccccccttaaaactctgcaagaagttaaacagaggagcccaacagtatgcagaggagctg
gcagcctcaaggatcctcaaacacagctctgagtctgctagtggaaaatgtggagaaaac
ttggcctgggcatcctacgatcaaccagggaaggatgttgccgacagatggtacagtgaa
ataaagaattacagctttcaaaacccagggttttcttcagggacaggtcatttcacagcg
atggtttggaagagcacaaagaaaatgggagttggaaaagcgtctgctagtgacggttct
acatttgtggtggctaggtacgatccagctggaaatgtagtaaatccaggctactatgaa
gaaaatgtccttcctccaagaaaataa

DBGET integrated database retrieval system