KEGG   Gallus gallus (chicken): 421004
Entry
421004            CDS       T01006                                 

Gene name
GMNN
Definition
(RefSeq) geminin
  KO
K10749  geminin
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:gga03032]
    421004 (GMNN)
DNA replication proteins [BR:gga03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    421004 (GMNN)
SSDB
Motif
Pfam: Geminin PGA2 Cas9_a DivIC DUF5101 UPF0242 FapA Csm1_N
Other DBs
NCBI-GeneID: 421004
NCBI-ProteinID: NP_001026181
CGNC: 10213
Ensembl: ENSGALG00000013626
UniProt: Q5ZKE6
Position
2
AA seq 224 aa
MNSKMKQSLNVENPSGSLQKYLTDTACSAAPRRTLKMIQPSAKGFLVGRCNEKKSSVKRK
LWNNRLTSSACKAEASVDKEQENENTDDVIQAIDLIKKSPSSQYWKEVAEERRKALYEVL
QENEKLHKEIEQKDGEIARLKEENEELMSLAEHVHYLTSMIERLTGQESDNLEALESLAL
DESNQENEDLNLGGDADSTSEGPSQVSCDLRKSVSDLASSEGNY
NT seq 675 nt   +upstreamnt  +downstreamnt
atgaattccaaaatgaaacaaagcctgaatgtggagaacccgtctggatctctgcagaag
tacctcacagacactgcatgcagtgctgccccgagacggactcttaagatgattcagcct
tctgcaaaaggtttcctggttggaaggtgtaatgagaagaagtcttcagtcaagaggaaa
ctctggaataacaggcttacctcctcagcttgtaaagctgaggcatctgtggacaaagag
caagaaaatgagaatacagatgatgtcattcaagctatagatctcataaaaaaaagtcct
tcatctcaatattggaaagaagtggctgaagaaaggaggaaggctctgtatgaagtgctt
caagaaaatgaaaagttgcacaaagagattgaacaaaaagatggtgaaattgcccgccta
aaggaggaaaatgaggaactcatgtcactggctgaacatgtgcattatttgaccagcatg
attgagaggctaacagggcaagaatctgataatcttgaggcactggaaagtctggcttta
gacgaatccaaccaagaaaatgaagaccttaaccttggaggtgatgcagacagcacttca
gaagggccatcacaagtatcatgtgacttaaggaagagtgtatcagatcttgcttcaagt
gaaggaaattactga

DBGET integrated database retrieval system