KEGG   Gallus gallus (chicken): 421013
Entry
421013            CDS       T01006                                 

Gene name
CNDP2
Definition
(RefSeq) cytosolic non-specific dipeptidase
  KO
K08660  cytosolic nonspecific dipeptidase [EC:3.4.13.18]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00330  Arginine and proline metabolism
gga00340  Histidine metabolism
gga00410  beta-Alanine metabolism
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    421013 (CNDP2)
   00340 Histidine metabolism
    421013 (CNDP2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    421013 (CNDP2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gga01002]
    421013 (CNDP2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gga04147]
    421013 (CNDP2)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.13  Dipeptidases
    3.4.13.18  cytosol nonspecific dipeptidase
     421013 (CNDP2)
Peptidases and inhibitors [BR:gga01002]
 Metallo peptidases
  Family M20
   421013 (CNDP2)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   421013 (CNDP2)
SSDB
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Other DBs
NCBI-GeneID: 421013
NCBI-ProteinID: NP_001006385
CGNC: 13892
Ensembl: ENSGALG00000019514
UniProt: Q5ZLV5
Position
2
AA seq 475 aa
MAALDTLFKYIDEHQDLYVKRLAEWVAIQSVSAWPEKRAEIRHMMEVAAKDIERLGGTAQ
LMDIGKQKLPDGSEIPLPPIILGKLGSDPQKKTVCVYGHLDVQPAALEDGWDSEPFTLVE
RDGKLYGRGSTDDKGPVLAWLNALEAYQKTNQEFPVNIKFCLEGMEESGSEGLDELIFAQ
RNAFFKDVDYICISDNYWLGKNKPCITYGLRGICYYFIEVECSDKDLHSGVYGGSIHEAM
TDLIALMGSLIDKKGKILIPGINEAVASVTDEELAIYEKIDFDLKEYAKDVGAAKLLHDT
KRDILMHRWRYPSLSLHGIEGAFSASGAKTVIPRKVIGKFSIRLVPNMTPEEVTKHVKDY
LSKKFAELQSPNKFKVYLGHGGKPWVSDFDHPHYMAGRKAMKTVFGVEPDLTREGGSIPV
TLTFQEATGKNVMLLPVGAADDGAHSQNEKLNRYNYIQGVKMLGAYLYEVSQLKD
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggctgctcttgacaccctctttaaatacattgatgaacaccaagacctttatgttaag
cggctggctgagtgggtagcaatccagagtgtgtcagcatggccagagaagagggctgaa
atcaggcacatgatggaagttgctgcaaaggatattgagcgactgggaggcacggctcaa
cttatggacattgggaaacaaaagctgcctgatggatcagagattcctctacctccaatt
attctgggaaagcttggctcagatccacagaaaaagactgtgtgtgtgtatggccaccta
gatgttcagccagcagcactggaggatggctgggacagtgagcccttcacactggtagaa
agagatggaaagctgtatgggagaggatcaacagatgacaaaggtccagtgcttgcctgg
ctgaatgccttggaggcttatcaaaaaactaatcaggaatttccagtaaatattaagttc
tgcctagagggtatggaggaatcaggatcagaaggccttgatgaactgatttttgctcag
cgcaatgctttcttcaaagatgtggattatatttgcatttctgacaactactggctaggc
aagaataaaccttgtatcacctatggcttgaggggtatttgctactacttcatagaggta
gaatgcagtgacaaagaccttcactctggagtttatggtggttcgatacatgaggccatg
acagatctcattgctctaatgggttctctcatagacaagaaggggaaaatcctcatcccg
ggcattaatgaagcagtggcatctgttactgatgaggagctggccatttatgagaagatt
gattttgacttaaaagaatatgcaaaagacgtaggagcagcaaaactattgcatgataca
aagagagatatccttatgcatagatggagatatccttccttgtctctccacggaattgaa
ggagccttctcagcctctggagccaagactgtgattcctaggaaagtgattggcaagttc
tcaatcagacttgtgccaaacatgactcctgaagaagtcacaaagcatgttaaagactac
ctgagcaaaaagtttgcggagctgcagagccctaacaaattcaaggtatacttaggccat
ggtggaaaaccttgggtgtcagactttgaccatccccactacatggctggcagaaaggcc
atgaagacagtgtttggagttgaaccagacctgacaagggagggaggaagcattcctgtt
accctcacttttcaagaagcaacaggcaagaatgtcatgctgcttcctgttggtgctgct
gatgatggtgcccactctcaaaatgagaaactgaacaggtacaactacattcagggagtg
aagatgcttggcgcatacctctatgaagtttcacaactgaaggactaa

DBGET integrated database retrieval system