KEGG   Gallus gallus (chicken): 421028
Entry
421028            CDS       T01006                                 

Gene name
DSEL
Definition
(RefSeq) dermatan-sulfate epimerase-like protein
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: Sulfotransfer_1 DUF4962 Sulfotransfer_3
Other DBs
NCBI-GeneID: 421028
NCBI-ProteinID: XP_004935280
CGNC: 10307
Ensembl: ENSGALG00000042505
UniProt: A0A1D5PUS3
Position
2
AA seq 1216 aa
MALMLTGHTLFLALMMFAVFTFEESVSNYSDWVTFMENLDQYDKEKLDSFGAEQKVKKVS
LHPSLYFDAEDVHVLRQKAHTSHSHIFRTIRSAVMVMLSNPMYYLPPPKYVDFAAKWNEV
YGNNLPPLAFYCLLCPEDKAALDFTVEYMDRMAAYKNWLVESAPGDEVPLGHSLTGFATA
YDFLYNSLENVRRQKYLEKIRSASKEMFEYSKVRSWGKQLLHNHQATNMLALLTGALVTG
VDDGSQANIWKHAVVDVMEKTMFLLNHIVDGSLDEGVAYGSYTAKSITQYVFLAQRHFGI
NNLENNWLKMHFWFYYATLLPGFQRTVGVADSNYNWFYGPESQLVFLDKFVLKNGAGNWL
AQQIRKHRPKDGPMVPSTAQRWSTLHTEFIWYSAEITPQPPPDYGTAKMHVFPNWGVVTY
GAGLPSSQTNTFVSFKSGKLGGRAVYDIVHFQPYAWIDGWRSFNPGHEHPDQNSFTFAPN
GQVFVSEALYGPKLSHLNNVLVFAPSPTSQCNQPWEGQLGECAQWLKWIGHEVGDSSGEI
ITASQSGDMMFVSGEAVSAYTSAMKLKSVYRILLLLNSQTLLVVDHIEKEADSPVNSVSA
FFHNLDIDFKYIPYKFKNKYNGAMMDVWDAHYKMFWFDHHGSSPVARIQEAEQAAEFKKR
WTQFVNVTFPMKSTLTRIVYLFYGPYVNVSNCRLIDNVKSGFQISLSVNSTENTVSVVTD
HQNLKARFDYLGFGGFAKVVHENKVTKFGLGTESVEKLIKNNRVVLPFGFKVNIIAGLIL
GVSLVILAFQWRFYVSFSKMLRWILILVITLWLTELVDVWSMCTQPICAKWSSDLTRLEH
DEGNKDKRLEGTSIVFPDVIITSLPASGAEILKQLFFNSSDFLYMRIPTAYLEIPESEFE
IDSFVDPCEWKASDVQNGHFHLLKGWLQSLVRDTKLHLQNIQLYEASRSKITQHSAINKD
KKKRSKKRESLLEQRSRARASQEKDAEYIRELRRHLVYYPSARTVLSLSSGSWTLKLPFF
QEILGPSMRALYVVRDPRAWIYSMLYKNKPSLYSLKKVPQRLAAMFKWENGKGKCSVNEG
YAFEYESLRKEFSNSNSNAVSVLSHLWLANTAAALRINGDLLPTNYLMVKFEDIVSFPQK
TAETIFAFLGIPLPPASLNQILFATSTSLFYLPYEGEISPSSIHAWKQNMPKKEIRLIED
TCFSLMEHLGYPKFVE
NT seq 3651 nt   +upstreamnt  +downstreamnt
atggctctgatgcttacagggcataccttatttctagcattaatgatgtttgctgtcttc
acttttgaagaatctgtaagcaattactctgattgggtgacttttatggaaaatctagat
caatatgacaaagagaaacttgatagttttggtgctgagcagaaggtgaaaaaagtatct
cttcatccaagcttgtatttcgatgctgaagacgtccatgtgctgaggcagaaagctcac
acaagccattcacatatattcagaaccatcagaagtgcggtgatggttatgttatccaac
cccatgtactacctacctccacccaaatatgttgattttgctgcaaagtggaatgaagtt
tatggtaataatctgccacctctagcattttattgtttgttgtgccctgaagataaagct
gcattagattttactgtggagtatatggacagaatggctgcttacaagaactggttggtt
gagagtgcgcctggtgatgaagtgccacttggccactccctaacgggatttgccactgct
tatgacttcctctataattcactggaaaatgtgagaagacaaaaatacctggagaagata
cggtctgcaagcaaggaaatgtttgagtactcaaaggttcgttcctggggaaagcagctt
cttcacaatcaccaagcaaccaacatgctcgctttgctcactggagctttagtgactggt
gtggacgatggatctcaggcaaatatttggaaacacgctgttgttgatgtgatggagaaa
acaatgtttctgctcaatcacattgtggatgggtctctggacgagggagtagcttatggg
agttacactgctaagtcaataacacagtatgttttcctggcacagcgacactttggtatt
aacaacttggaaaataattggctcaaaatgcacttttggttttattatgccacgctatta
ccaggctttcaaaggactgtgggtgtagcggattctaattacaattggttttatggtcct
gagagtcagctggttttcttggataagtttgtcctgaagaatggagctggcaactggctg
gcacagcaaattagaaaacacagacccaaagatggaccaatggtaccatccactgcacag
aggtggagcactctgcacacagagtttatatggtactctgctgaaatcactcctcaacca
cctcctgactatggcactgctaaaatgcacgtgtttcctaactggggagttgttacttat
ggggctggattgccaagcagtcagacaaacacctttgtgtccttcaagtctggaaaactg
ggtggacgggctgtttatgatattgtccactttcaaccatatgcctggattgatggatgg
agaagttttaatcctggacatgagcatcctgatcagaactctttcacttttgctcccaat
gggcaggtgtttgtatctgaggctctctacggacctaagctcagccacctgaacaatgtc
ttggtgtttgccccatctcctacgagccagtgtaaccagccttgggagggacagcttggt
gaatgtgcccagtggctgaagtggattggtcatgaggttggagactcaagtggggaaatt
ataacagcctcccagtctggagacatgatgtttgtgagtggggaggcagtgtctgcttat
acatcagcaatgaaattgaaaagtgtgtaccgcattttgctgctcctaaattctcagacc
ttgttagtagtagaccacattgagaaggaggcagactctcctgttaattcagtcagtgcc
ttttttcataatcttgacattgattttaaatatataccctataaatttaagaacaagtac
aatggagctatgatggatgtgtgggatgcccactacaagatgttttggtttgatcatcat
gggagtagtcctgttgctaggatacaagaggcagaacaagctgctgaattcaaaaagcga
tggactcagtttgtaaatgttacctttccaatgaaaagcactcttacaaggattgtttac
cttttctatggcccgtatgtcaatgtttctaactgcaggctcattgataatgtaaagtct
ggatttcagatatcacttagtgtcaacagcacagaaaatactgtttctgttgtgactgat
catcagaatttaaaggctaggttcgattacttgggatttggtggttttgccaaagttgtt
catgaaaacaaagtgactaaatttggtctaggtactgaatctgtggaaaaattgattaaa
aataatagggtagttttgccatttggattcaaagtgaacataattgcagggttaatttta
ggtgttagtttagtcatactggcctttcagtggcggttttacgtatctttcagtaaaatg
ttgcgttggatcctgatactggttatcacactgtggcttactgaactggtcgatgtatgg
agcatgtgtactcagccaatctgtgcaaaatggagcagtgacttgacaaggctagaacac
gatgaaggcaataaagacaaacgattagaagggacttccattgtttttccagatgttata
attacttcacttcctgcttctggtgcagaaattttaaaacagctgttcttcaacagcagt
gacttcctatacatgaggatacctacagcctatctagaaattcctgagagtgaatttgaa
attgattcctttgtagatccatgtgaatggaaggcttctgatgttcagaatgggcatttt
catcttctcaaggggtggctccagtctctagttcgagacacaaaattgcatttacaaaac
attcagttatatgaagccagcagaagtaaaattactcagcattctgccataaacaaggac
aaaaagaaaagatccaaaaagagagaatctctgttggagcaaagaagcagggcaagagcg
agtcaagaaaaagatgctgaatatattagggaattgagaagacaccttgtttattatcct
agtgcacgaacggtgcttagtttaagtagtgggagctggacattaaagcttcccttcttt
caggaaatcctaggaccatcaatgagagcattatatgtagtaagagatccacgggcatgg
atatattcgatgctgtacaaaaataagccaagcctttactctttgaaaaaggttccacag
cgcttagctgcaatgtttaaatgggaaaatggtaaaggaaaatgtagtgtcaatgaaggc
tatgcctttgaatatgaatcattaagaaaagaattttcaaattctaattcaaatgctgtt
tctgtgttgtcccatttatggctagcaaacacagcagcagcactgagaataaatggagac
ttgctgccaacaaattatctgatggtcaaatttgaagatattgtgagctttcctcagaag
acagctgaaacaatttttgcctttcttggtattcctcttcctcctgctagcttaaaccaa
atattatttgccacttccaccagtcttttctatcttccttatgagggggaaatttcacca
agtagcattcatgcctggaaacaaaacatgcccaagaaagaaattagactgattgaagat
acctgtttttctctaatggaacacttaggatacccaaagtttgtagaataa

DBGET integrated database retrieval system