KEGG   Gallus gallus (chicken): 421029Help
Entry
421029            CDS       T01006                                 

Gene name
CDH19
Definition
(RefSeq) cadherin-19 precursor
  KO
K06806  cadherin 19, type 2
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:gga04515]
    421029 (CDH19)
Cell adhesion molecules [BR:gga04515]
 Cadherins
  Major cadherins
   421029 (CDH19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Cadherin_C Cadherin_2 Cadherin_3 Cadherin_4 Phage_holin_3_6 Herpes_UL82_83
Motif
Other DBs
NCBI-GeneID: 421029
NCBI-ProteinID: NP_001093757
CGNC: 10314
Ensembl: ENSGALG00000013775
UniProt: A6YJX3
Position
2
AA seq 776 aa AA seqDB search
MNCSTFLSLVLALVQLQLCSPTTQIFSAQKTDQSYTTIRRVKRGWVWEPLFVTEEETSTM
PMYVGQLKSDLDKEDGSLQYILTGEGADSIFFINEHGKIYVRQKLDREKKSFYILRAQVI
NRKTRHPIEPDSEFIIKVRDINDHEPQFLDGPYVATVPEMSPEGTSVTQVTATDGDDPSY
GNNARLLYSLIQGQPYFSVEPKTGVIRMTSQMDRETKDQYLVVIQAKDMVGQAGAFSATA
TVTINLSDVNDNPPKFQQRLYYLNVSEEAPVGTTVGRLLAEDSDIGENAAMNYFIEEDSS
DVFGIITDRETQEGIIILKKRVDYESKRKHSVRVKAVNRYIDDRFLKEGPFEDITIVQIS
VVDADEPPVFTLESYVMEIAEGVVSGSLVGTVSARDLDNDDSSVRYSIVQGLHLKRLFSI
NEHNGTIITTEPLDREKASWHNITVTATETRNPEKISEANVYIQVLDVNDHAPEFSKYYE
TFVCENAVPGQLIQNISAVDKDDSAENHRFYFSLAQATNSSHFTVKDNQDNTAGIFTAGS
GFSRKEQFYFFLPILILDNGSPPLTSTNTLTVTVCDCDTEVNTLYCRYGAFLYSIGLSTE
ALVAVLACLLILLVFFLAIIGIRQQRKKTLFSEKVEEFRENIVRYDDEGGGEEDTEAFDI
SALRTRAVLRTHKPRKKITTEIHSLYRQSLQVGPDSAIFRQFISEKLEEANTDPSVPPYD
SLQTYAFEGTGSLAGSLSSLGSNTSDVDQNYEYLVGWGPPFKQLAGMYTSQRSTRD
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgaattgctccactttcctctctcttgtgctggcactggttcaacttcaactttgttct
ccaaccacacagatcttcagtgctcaaaagacagatcagtcttacacaacaattcgaaga
gtgaagcgtggctgggtatgggagccactttttgtaactgaggaagagacctcaacgatg
cctatgtatgttggacagctgaaatcagatttagacaaggaggatggcagcctacaatat
attttgactggggagggagctgacagcatttttttcatcaatgaacatggcaaaatttac
gtgaggcaaaagctggatagagaaaagaaatccttctacattctaagagcccaagtaatt
aataggaaaactcgtcatcctattgaacctgattcagaatttattatcaaagttcgagat
atcaatgaccatgaaccacaattcttagatggaccttatgtggctactgttccagagatg
tcacctgaaggtacttctgttacacaggtaacagctacagatggtgatgatccttcctat
gggaataatgcccggctgctttacagtctcattcagggtcagccttatttctctgtggag
ccaaagacaggagtcatcagaatgacttcccaaatggacagagaaacaaaagatcagtat
ttggttgtcattcaagccaaagatatggttggacaagcaggagcattttcagcaacggcc
actgttaccatcaacctctctgacgtcaatgacaatccacctaaatttcagcagagactc
tactatttgaatgtctccgaggaagctcctgtgggcacaactgtaggcagactcttggca
gaagacagcgacataggggagaatgcagccatgaactatttcattgaagaagatagttca
gatgtttttggcatcattactgatagggagactcaggaaggaattatcatactaaagaag
agagtggattatgagagcaagagaaaacatagtgttagagtaaaagctgtaaacaggtac
attgatgatcgtttccttaaagaaggaccatttgaagacataactattgtacaaatcagt
gtggtagatgctgatgaacctccagttttcaccttggagagctacgtgatggagattgct
gaaggagttgtaagtggctcattggtaggaactgtatccgcaagagatctggacaatgat
gacagctcagtcaggtattctattgtccaaggcttgcatttaaagagattgttcagcatc
aatgaacacaatggaacaatcattacaactgaacctctggaccgagagaaagcttcttgg
cacaacataactgttacagccacagaaactagaaatcctgaaaaaatttcagaagcaaat
gtatatatccaagttcttgatgtaaatgaccatgcaccagaattctctaaatattatgaa
acatttgtttgtgaaaatgcagtacctggtcagctaattcaaaacatcagtgcagtggat
aaagatgattcagcagaaaatcaccgattttacttctcattggctcaggccacaaacagc
tcacattttactgtcaaagataatcaagataacacagctggaattttcacagcaggaagt
ggcttcagtagaaaagagcagttttatttcttcttgccaatcttaattctggataatgga
tctccaccacttacaagcacaaatacactcactgtcactgtctgtgactgtgatactgaa
gtgaacaccttatactgtcgatatggagctttcctgtattccataggcctcagcacagaa
gctttagttgctgttttggcttgcctactaatactcctggtgttctttttggcgattata
ggcataagacagcagaggaagaagactctcttttcagagaaagtggaagaattcagagag
aacattgtcagatatgatgatgaaggaggtggtgaggaggacacagaagcttttgatatt
tcagcactgaggacacgcgctgtcttgagaacacacaaacctcgaaagaaaatcaccaca
gaaatccacagcctctacagacagtctctgcaggttggtcctgacagtgctattttcagg
caattcatttcagaaaagcttgaagaagccaatacagacccgagtgttcctccatatgac
tcacttcagacatatgcttttgaggggactggctctttggcaggatctctcagctcctta
ggctcaaatacatcagatgtggatcaaaattatgaataccttgtaggctggggacctcca
tttaaacagcttgcaggcatgtacacttcccaaaggagtactagagattag

DBGET integrated database retrieval system