KEGG   Gallus gallus (chicken): 421044
Entry
421044            CDS       T01006                                 

Gene name
LDLRAD4
Definition
(RefSeq) low-density lipoprotein receptor class A domain-containing protein 4
Organism
gga  Gallus gallus (chicken)
SSDB
Other DBs
NCBI-GeneID: 421044
NCBI-ProteinID: NP_001026184
CGNC: 51390
Ensembl: ENSGALG00000013886
UniProt: E1BYM2 Q5ZJR6
Position
2
AA seq 233 aa
MVVVIICLLNHYKLSTRSFINRQSQSRRQEDTLQTEGCLWPSESSVSRQGASEIMYAPRS
RDRFTAPSFMQRDRFSRFQPTYPYMQHEIDLPPTISLSDGEEPPPYQGPCTLQLRDPEQQ
MELNRESVRAPPNRTIFDSDLIDISMYNGGPCPPSSNSGISATNYSSNGRMEGPPPTYSE
VMGHYPGSSFFHHQHSNAPPSSQRGSRLQFQQNNSESTIVPSKGQDRKPGNLV
NT seq 702 nt   +upstreamnt  +downstreamnt
atggtggtagtgatcatctgcttgttgaaccattacaaactatcgacgcgctcctttatc
aaccggcagagccaaagcagaagacaggaggatactttgcagacagaagggtgcttgtgg
ccttcggaaagctcagtttcacgccagggtgcttcagagattatgtatgctccaaggtcc
agggacaggtttaccgccccatcttttatgcagcgggaccgtttcagtcgcttccagccc
acttacccatacatgcagcatgagattgaccttcctccaaccatttccctctcagatggg
gaagagccgccgccataccaaggcccgtgcaccctgcagctccgggacccagagcagcag
atggagctcaaccgggaatctgtcagggcaccgcccaaccgaaccatttttgatagcgac
ttgatagacatttccatgtacaatgggggcccctgcccaccgagcagcaattcgggcata
agtgcaaccaactatagcagtaatggaaggatggaaggaccacccccgacgtacagcgag
gtcatggggcactacccaggctcctcgtttttccatcaccagcacagcaacgctcctcct
tcctcgcagagggggagcagacttcagtttcagcagaacaattcagagagcacaattgtc
cccagcaaaggccaagaccggaaaccagggaacctggtctaa

DBGET integrated database retrieval system