KEGG   Gallus gallus (chicken): 421067
Entry
421067            CDS       T01006                                 

Gene name
ESCO1
Definition
(RefSeq) N-acetyltransferase ESCO1
  KO
K11268  N-acetyltransferase [EC:2.3.1.-]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    421067 (ESCO1)
Enzymes [BR:gga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     421067 (ESCO1)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Adherin complex
    421067 (ESCO1)
SSDB
Motif
Pfam: Acetyltransf_13 zf-C2H2_3 bMG10
Other DBs
NCBI-GeneID: 421067
NCBI-ProteinID: XP_419155
CGNC: 11088
Ensembl: ENSGALG00000014936
UniProt: F1NTQ0
Position
2
AA seq 856 aa
MAAQKRKSALVEPSAKRPRLDKNSRPSSAKKEKEVSDAKHVSNKSNSNQCAVQEKSVLRT
SVKSNSVNTNESELGTRMTTRSSGFNSSSKTVPDKKAQQQPKSTKSKEVCQKKPAQEIPK
SKCVTAPSESGARRSQRLQQLTHVEEPARSLRSREVKEEKASDVKQSSQAKRPAQNVAAK
ALKPAGEKAEQKNTKTKSNNAKEDKETRVEVTSSPKEKKCKADKKNDNSKSLQHSVQDSS
LCPDDGLEEVKKDQKDPVSPVLSSTKKVKADSPKPNSKTVTKEKQQVHQNIKGSIKPNKV
SQPSVSETKVADQPESDVKSKRVSILELCEEIAGEIESDTVEVKKDSPNAECSKTEEEKH
AEVQLQQSEMLTQKEPAQSAQCKRFFPSKKGMPVKCTLNGRSNSSNKNSKWTKIKLLKAN
NMKQTNLNSANAPKLSLLKNFPEVSEASQIATEAQHSKVEGQLPVTRLSENESATCVQDK
SDPSSERAGSKEVALEMKQPTKRGVENGLLHNLTKHFSEPRPDENFKLRLESSPESSPVK
HLTAPKPSKQLKREPGECDPQVVGLAPKQLTHTSSTNQTSEPENRVPSTNPALTSKCSNL
LPSEEHIQKLKEAGKDGEKQLIIDAGQKRFGAISCNICGMLYTASNPEDETQHLLFHNQF
ISAVKYVGWKKERILAEYPDGRIIMVLPDDPKYALKKVEEIREMVDNDLGFQQAPLMCYS
RTKTLLFISNDKKVIGCLIAEHIQWGYRVIEEKVPEISSENEMVIFERQKAWCCSTSPEP
AICGISRIWVFSMMRRKKIASRMIECLRSNFIYGSYLSKEEIAFSDPTPDGKLFATQYCG
TGQFLVYNFLNGQHQA
NT seq 2571 nt   +upstreamnt  +downstreamnt
atggcagctcagaaaaggaagtctgcgttagtagagccatctgctaaacgtcccaggctg
gacaagaacagcagaccatcgtcagcaaagaaggagaaagaggtgtcagatgcaaagcat
gtctcaaataaatcaaactctaatcagtgtgcagtgcaggagaaatctgtactcagaacc
tctgtcaaatcaaacagtgtcaacacaaatgaatctgaactaggaacacgcatgactaca
aggtcatcgggattcaactcaagtagtaaaacagtacctgacaaaaaggcccaacagcag
cctaagtctacaaaaagtaaagaggtgtgccagaaaaaacctgcgcaagagattcctaag
tcgaaatgtgtaactgctccaagtgagtctggtgcgaggagatcacagaggctgcagcag
ctaacacacgtggaagagcctgcgagatcccttcgcagcagagaagttaaagaagaaaaa
gcttcggatgtgaaacagagtagccaggcgaaaagacctgctcagaatgtcgcagcgaaa
gcacttaaacctgctggagagaaagcagaacagaagaacaccaaaacaaagtcaaacaat
gcaaaagaagataaagaaacacgtgtagaagtgaccagctctccgaaagagaagaagtgt
aaggcagacaagaaaaatgataattcaaaaagccttcaacacagcgttcaagactcgtcg
ttatgtcctgatgacggccttgaggaagttaagaaagaccaaaaagaccctgtatctccc
gttcttagcagcacaaagaaagtgaaagcagattctccgaagccaaattctaagacagta
actaaggaaaagcaacaagtgcaccagaacataaaaggcagtataaaaccaaacaaggtt
tcacagccatctgtaagtgaaacaaaagtagctgatcaacccgagagcgatgtgaaatcc
aaaagggtgagcatccttgaactttgtgaagaaattgcgggtgaaattgagtcagataca
gtagaggtgaaaaaagattcccctaatgctgagtgtagtaaaacagaagaggaaaagcac
gctgaagtacagctgcaacaaagtgaaatgcttacgcagaaagaacctgctcaaagtgct
cagtgcaaacgttttttccctagcaaaaaaggaatgcctgtcaagtgtactttgaatggt
agaagtaactcctcaaacaaaaactctaaatggaccaaaattaaattactgaaagctaat
aacatgaagcagactaacttaaattctgctaatgcccccaagctttctttgttaaaaaat
ttccctgaagtttcagaggcaagtcaaatagctacggaagcacaacattctaaggtggaa
ggtcagctgccagtgacaagactgtctgagaatgaaagtgcaacttgtgtgcaggataag
tcagacccttcatctgaaagagctggaagtaaagaagtggcattggaaatgaaacaaccc
acgaaaagaggtgtggaaaatggtttgttgcataatttgacaaaacatttctctgagcct
cgacccgatgagaacttcaaattacgtttggagtcaagtccagaaagttctccagtgaag
catcttacagctcctaaaccatcaaaacaattaaaaagagagcctggagaatgcgatcca
caagttgtaggtttggctcccaagcagttgacgcacacttcatctacaaatcaaacttct
gaacctgagaacagggttccatcaacaaatcctgcattaacatcaaagtgcagtaacttg
ctaccatctgaggagcatattcaaaagctaaaagaagcaggaaaagacggcgaaaagcag
ctgatcatagatgcaggacagaagagatttggtgctatttcttgtaatatttgtggaatg
ctttatactgcatcaaatccagaggatgaaacccaacacctcctctttcataaccagttc
ataagtgctgtaaaatatgtgggatggaaaaaggagagaattttggctgaatatcccgat
gggaggataataatggttcttcctgatgacccaaagtacgcacttaaaaaggttgaagaa
attagagaaatggtagacaatgacttgggatttcagcaagctccgctcatgtgttactcg
agaacgaaaactcttctttttatttctaatgacaaaaaagttattggctgtttaattgca
gaacatatccaatggggctacagagtgatagaagagaaggttccagaaattagttcagaa
aacgagatggtcatatttgaaagacagaaagcgtggtgctgctcaacctccccagagcct
gccatctgtgggatcagtcgaatatgggtgttcagcatgatgcgtcgaaagaagattgct
tctcggatgatagagtgtcttaggagcaacttcatatatggctcatatttaagtaaagaa
gaaattgcattctcagaccccactcccgatggcaaactctttgcgacacagtactgcggc
accggccagttcctggtgtacaacttcctcaacgggcagcaccaggcttga

DBGET integrated database retrieval system