KEGG   Gallus gallus (chicken): 421083
Entry
421083            CDS       T01006                                 

Gene name
ZNF521
Definition
(RefSeq) zinc finger protein 521 isoform X1
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: zf-C2H2_4 zf-C2H2 zf-C2H2_6 zf-Di19 zf-H2C2_2 zf-C2H2_jaz zf-C2H2_2 zf-met zf-C2H2_8
Other DBs
NCBI-GeneID: 421083
NCBI-ProteinID: XP_004939860
CGNC: 11244
Ensembl: ENSGALG00000015112
Position
2
AA seq 1383 aa
MALGALLPFSIIMWTTGATAQSKTLQLFAFRMSRRKQAKPRSLKETQILETTNCMKPWGW
RRRKRVEENETEDLQAGVGHTAAQTDPNCKLEDKTEDGEVLDCKKRPDEGEELEEEAVHS
CDSCLQVFESLSDITEHKINQCQLTDGVDVEDDPTCSWPASSPSSKDQTSPSHGEGCDFG
EEEGGPGLPYQCQFCDKSFSRLSYLKHHEQSHSDKLPFKCTYCSRLFKHKRSRDRHIKLH
TGDKKYHCSECDAAFSRSDHLKIHLKTHTSNKPYKCAICRRGFLSSSSLHGHMQVHERNK
DGSQSASRMEDWKMKDTQKCSQCEEGFDFPEDLQKHIAECHPECSPNEDRSALQCVYCHE
LFVEETSLVNHMEQAHNGEKKNSCSICSENFHTVEELYSHMDSHQQPESCNHSNSPSLVT
VGYTSVSSTTPDSNLSVDSSTMVETAPPIPKGRGRKRAAQQVPDITGPSSKQAKVTYSCI
YCNKQLFSSLAVLQIHLKTMHLDKPEQAHICQYCLEVLPSLYNLNEHLKQVHEAPDPGLI
VSTMPAMVYQCNFCSEVFNDLNTLQEHIRCSHGFANPAAKDSNAFFCPHCYMGFLTDSSL
EEHIRQVHCDLSSSRFGSPVLGTPKDPVVEVYSCSYCTNSPIFNSVLKLNKHIKENHKNI
PLALNYIHNGKKSRAMSPLSPVTIEQTSLKMMQAVGGAPPRPAGEYICNQCGAKYTSLDG
FQTHLKTHLDTVLPKLTCPQCNKEFPNQESLLKHVTIHFMITSTYYICESCDKQFTSVDD
LQKHLLDMHTFVFFRCTLCQEVFDSKVSIQLHLAVKHSNEKKVYRCTSCNWDFRNETDLQ
LHVKHNHLENQGKVHKCIFCGESFGTEVELQCHITTHSKKYNCKFCSKAFHAIILLEKHL
REKHCVFETKTPNCGTNGASEQVQKEEVELQTLLTNSQESHNSHDGSEEDVDTSEPMYGC
DICGAAYTMETLLQNHQLRDHNIRPGESAIVKKKAELIKGNYKCNVCSRTFFSENGLREH
MQTHLGPVKHYMCPICGERFPSLLTLTEHKVTHSKSLDTGNCRICKMPLQSEEEFLEHCQ
MHPDLRNSLTGFRCVVCMQTVTSTLELKIHGTFHMQKTGNGSAVQSTGRAQHLQKLYKCA
SCLKEFRSKQDLVKLDINGLPYGLCASCVNLSKSGSPSVNIPSSSNRQGMGQNENLSSIE
NKSKAGGLKTRCSSCNVKFESESELQNHIQSIHRELVPDSNSTQLKTPQVSPMPRISPSQ
TEEKKTYQCIKCQMVFYNEWDIQVHVANHMIDEGLNHECKLCNQTFDSPAKLQCHLIEHS
FEGMGGTFKCPVCFTVFVQANKLQQHIFSAHGQEDKIYDCTQCPQKFFFQTELQNHTMTQ
HSS
NT seq 4152 nt   +upstreamnt  +downstreamnt
atggctttgggggccttgcttccattttccattattatgtggactaccggagcgacagcg
cagtccaagaccttgcagctgtttgcttttaggatgtctcgccgcaagcaagctaaaccg
agatcactcaaagaaacccagattctagaaacaaccaattgtatgaagccttggggttgg
cggaggaggaaaagagtagaagaaaatgaaacagaggacctgcaggcaggtgtgggacac
acagccgcgcagactgaccctaactgtaaactagaagacaagacagaagatggagaagtg
ttagactgtaagaaaaggccggatgaaggggaggagttggaagaagaagccgtgcacagc
tgtgacagctgcctccaggtgtttgagtcgctgagtgatatcacagaacacaagattaat
caatgtcaactgacagatggagtggatgttgaggatgaccccacttgctcatggccagca
tcatcgccttccagcaaggaccagacttccccaagccatggagaaggttgtgattttggt
gaggaggaaggaggcccagggttgccctatcagtgccagttttgtgacaaatcgttcagc
cgcctcagctacttaaagcaccacgagcaaagtcacagtgacaaactccctttcaaatgc
acttattgcagtcgtctcttcaaacacaaacgaagcagggaccgccacataaagcttcat
acgggagacaagaagtatcactgcagtgagtgtgatgcagcattctcaaggagcgatcat
cttaaaattcacttaaagactcatacgtccaacaagccatataaatgtgccatttgtaga
cgtggattcctgtcatccagttcgctgcacggccacatgcaggttcacgagaggaacaag
gatggctctcagtctgcttcccggatggaggactggaaaatgaaggacactcagaagtgc
agtcagtgtgaagaaggctttgattttcctgaagatcttcagaagcacattgcggaatgt
caccctgagtgttctcctaatgaagaccgatctgctctccagtgtgtttactgtcacgaa
ctctttgtagaggaaacgtctctggtgaatcacatggagcaggctcataatggtgagaag
aagaattcatgcagcatttgctctgagaactttcacactgtggaagagctgtacagccac
atggacagtcaccagcagccagaatcatgcaaccacagcaacagcccatcattggtaact
gttggctacacctcagtctcaagtaccactccagattccaatctctctgtggatagttca
acaatggtggaaacggctccccctataccaaaaggccgtggaagaaagcgggcagctcag
caagtgccagatatcactggtccttcaagtaaacaggcaaaagttacctatagctgcatt
tattgcaacaaacagttattttccagccttgcagttttgcagatacacctgaaaactatg
catttagataaacctgaacaagcccatatctgtcagtattgtttggaggtattgccatct
ctctacaatctgaacgaacatcttaagcaagtccacgaagctccggatccagggctgatt
gtttccactatgcctgccatggtgtaccagtgcaacttctgctctgaagtgttcaatgac
ctcaacacgcttcaagaacatatccgatgttctcatggatttgccaaccctgctgctaag
gacagtaatgcgttcttttgcccccattgctacatggggtttcttacagattcttctctg
gaagagcatattagacaagtccattgtgatcttagcagttcccgttttggttcccctgtg
ctcggaaccccaaaagatccagtagtggaagtgtattcttgttcttactgtacaaattct
ccaatatttaatagcgttcttaaactgaacaagcatatcaaggagaaccataagaacatt
cctttggcactgaattacatccacaatggaaaaaaatccagagccatgagtcccttatct
cctgtaacgattgagcagacctctttaaaaatgatgcaggcggttggaggtgctcctcct
cgtcctgcaggtgaatatatttgtaatcaatgtggtgctaagtatacttctttggacggt
tttcagactcatttaaaaacacatcttgatactgtcctgccaaaactgacctgccctcag
tgcaacaaggagtttccaaatcaggagtctctgctgaagcatgttaccattcattttatg
atcacttcaacctactacatctgtgaaagctgtgacaagcagtttacttctgtggatgac
ttgcagaagcacctactagacatgcatacatttgtattcttccgctgcaccttgtgccaa
gaggtttttgactccaaagtctccatccaactacacttggctgtgaagcacagcaatgaa
aagaaggtatataggtgtacgtcttgcaactgggatttccgcaatgagactgacctacag
cttcacgttaaacacaaccacttggagaaccaaggcaaagtgcacaagtgcatcttctgt
ggtgagtcctttggtacagaggtggagctgcagtgccatattactacgcacagcaagaag
tacaactgtaagttctgcagcaaagctttccatgccatcatcctgctggaaaagcattta
agggaaaaacattgtgtttttgaaacaaaaactccaaattgtggaacgaatggggcatct
gaacaggttcagaaggaagaagtggagctccagaccttgttgacaaatagccaggagtcc
cataacagccatgatggcagcgaagaggatgtggacacatctgagcctatgtatggctgt
gacatttgtggagcggcttacaccatggagactctcctgcaaaaccaccagcttcgagac
cacaacattcgacctggagaaagtgccatagtgaagaaaaaggctgaactcattaaaggg
aattacaagtgtaatgtgtgttctcgaacattcttctctgaaaatgggctccgagaacac
atgcagacacacttgggaccagtgaaacattacatgtgcccaatctgtggcgagcggttt
ccatctcttctgactcttactgaacataaagtcacacatagtaagagcctggacaccgga
aactgcaggatttgcaagatgcctctccagagtgaggaggaatttttagagcattgccag
atgcaccctgacttgaggaactctttgacagggttccgctgtgtggtgtgcatgcagact
gtgacctccacgttggaactgaaaatccacggcacattccacatgcagaaaactggaaat
ggttctgccgtgcagtccacggggcgcgcacagcatctccagaaactgtacaagtgtgct
tcttgcctgaaggaatttcgttcaaaacaggatttagtgaaacttgacatcaatggtctg
ccatatggtctgtgtgctagctgtgttaatctcagtaaaagtggtagtccaagtgtcaac
atcccatcaagcagtaacagacaaggcatgggccaaaatgagaacttgagttccattgag
aacaaaagcaaggcagggggactgaagactcgatgttctagttgcaatgttaaatttgaa
tcagaaagtgaactccaaaaccatattcagtcaatccacagagagcttgttccagacagc
aacagtacacagctgaaaacaccacaagtatctccaatgcccagaatcagcccctcccaa
actgaagagaagaagacctaccagtgcatcaaatgtcagatggttttctacaatgaatgg
gatatccaagttcatgttgcaaaccacatgattgatgaaggactgaaccatgaatgcaag
ctctgcaatcagacatttgactctcctgccaaacttcagtgccacctgatagagcacagc
tttgaaggcatggggggcaccttcaaatgtccagtgtgctttacagtgtttgtccaagca
aacaagttgcagcagcacattttctcagcccatggacaagaggacaagatctatgactgc
acacagtgtccacagaagttcttcttccaaacagagctgcagaatcatacgatgacccag
catagcagttag

DBGET integrated database retrieval system