KEGG   Gallus gallus (chicken): 421140
Entry
421140            CDS       T01006                                 

Gene name
CHD7
Definition
(RefSeq) chromodomain-helicase-DNA-binding protein 7
  KO
K14437  chromodomain-helicase-DNA-binding protein 7 [EC:3.6.4.12]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    421140 (CHD7)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     421140 (CHD7)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    421140 (CHD7)
SSDB
Motif
Pfam: SNF2_N BRK Chromo Helicase_C ResIII Myb_DNA-bind_7
Other DBs
NCBI-GeneID: 421140
NCBI-ProteinID: NP_001071054
CGNC: 51424
Ensembl: ENSGALG00000041080
UniProt: Q06A37
Position
2
AA seq 3011 aa
MADPGMMSLFGEDGNIFSEGLEGLGECGYPENTVNPMGQQMPMDQGFPSLQSSLHHPPAN
QNQAKLTHFDHYNQYEQQKMHLMDQPNRMISNAPGNGIASPHSQYHNPPVPQVPHGSGAS
GQMGVYPSMQNERHGQPFVDSGSMWGPRAVQVPDQIRAPYQQQQQQPQPTQPPQAPSGPP
GQGHPQHMQQMGNYMARGDFSMQQHGQPQQQRMNQFSQGQEGLNQGNPFIATSGPGHLSH
VPQQNPSMAPSLRHSVQQFHHHPPTALHGESVAHSPRFSPNPPQQGAVRPQTLNFSSRSQ
TVPSPTINNSGQYSRYPYSNLNQGLVNNTGMNQNLGLTNNTPMNQSVPRYPNAVGFPSNS
GQGLMHQQPIHPSGSLNQMNTQTMHPSQPQGTYASPPPMSPMKAMSNPAGTPPPQVRPGS
AGIPMEVGSYPNIPHPQPSHQPPGAMGIGQRNMGPRNMQQNRPFMGMSSTPREMGGHMRP
NGCPGVGLADPQAIQERLISGQQLPSQQQSFQQQMPTCPPMQPHPGIHHQSSPPPHPHHQ
PWAQLHQSPQNTPQKVPVLQHSPSEPFLEKPVPDMTQVSGPNTQLVKSDDYLPSVEPQPQ
QKKKKKKNNHIAAEGPSKSFGKEDFPGGLDSQNLSRNSVDCSQEDKKKKKKPKAKKEPKD
PKEPKEKKEPKTPKVPKTPKEPKEKKAKNTTPKPKTSKKTSNKKTDSESSAAKKKVNKGK
EGSENSDLDKTPPPSPHPEDEDDPGVQKRRSSRQVKRKRYTEDLEFKISDEEADDADAAG
RDSPSNTSQSEQQESADAEGPVVEKIMSSRSVKKKMENGEEVEIEEFYVKYKNFSYLHCQ
WASVEELDKDKRIQQKIKRFKAKQGQNKFLSEIDDELFNPDYVEIDRILDFSRSTDDNGE
PVTHYLVKWCSLPYEDSTWELKQDIDQAKIEEFEKLMSREPEMERVERPPADDWKKSESS
REYKNNNKLREYQLEGVNWLLFNWYNTRNCILADEMGLGKTIQSITFLYEIYLKGIHGPF
LVIAPLSTIPNWEREFRTWTELNVVVYHGSQASRRTIQLYEMYFKDPQGRVIKGSYKFHA
IITTFEMILTDCPELRNIPWRCVVIDEAHRLKNRNCKLLEGLKMMDLEHKVLLTGTPLQN
TVEELFSLLHFLEPGRFPSETTFMQEFGDLKTEEQVQKLQAILKPMMLRRLKEDVEKNLA
PKEETIIEVELTNIQKKYYRAILEKNFAFLSKGGGQANVPNLLNTMMELRKCCNHPYLIN
GAEEKILEEFKETHNADSPDFQLQAMIQAAGKLVLIDKLLPKLKAGGHRVLIFSQMVRCL
DILEDYLIQRRYPYERIDGRVRGNLRQAAIDRFSRPDSDRFVFLLCTRAGGLGINLTAAD
TCIIFDSDWNPQNDLQAQARCHRIGQSKSVKIYRLITRNSYEREMFDKASLKLGLDKAVL
QSMSGRENATNGVQQLSKKEIEDLLRKGAYGALMDEEDEGSKFCEEDIDQILLRRTHTIT
IESEGKGSTFAKASFVASGNRTDISLDDPNFWQKWAKKAELDIDALNGRNNLVIDTPRVR
KQTRLYSAVKEDELMEFSDLESDSEEKPSTKPRRPQDKSQGYARSECFRVEKNLLVYGWG
RWTDILSHGRYKRQLTEQDVETICRTILVYCLNHYKGDENIKSFIWDLITPTADGQTRAL
VNHSGLSAPVPRGRKGKKVKAQSSQPMLQDADWLTTCNPDVLFQEDSYRKHLKHHCNKVL
LRVRMLYYLRQEVIGDQADRILEGADSSEVDVWIPEPFHAEVPADWWDKEADKSLLIGVF
KHGYEKYNSMRADSTLCFLERVGMPDAKAIAAEQRGTDMLADGGDGGEFDREDEDPEYKP
TRTPFKDEIDEFANSPPEDKEESIEIHPNKHSESNSELGQLYWPNTSTLTTRLRRLITAY
QRSYKRQQMRQEALMKTDRRRRRPREEVRALEAEREAIITEKRQKWTRREEADFYRVVST
FGIIFDPIKHQFDWNQFRAFARLDKKSDESLEKYFNGFVNMCRRVCRMPVKPDDEPPDLS
TMIEPITEERASRTLYRIELLRKIREQVLHHPQLGERLKLCQPSLDLPEWWECGKHDKDL
LIGAAKHGVSRTDYHILNDPELSFLEAHKNFAQNRGTGNANTVSSLHPVGAGCSQTPPIV
PSTPVQEEKSTEQTESKVEGSENPAAKEKSDIKEETDIADKDTKQDCDAEAETGSVKCEL
KDIEMSTDVDPKSISEKGSEEDEEEKLDDDDKSEESSQPEAGAVSQGKNFDEESNASMST
ARDETRDGFYMEDGDPSVVQLLHERTFAFSFWPKDRVMINRLDNICEAVLKGKWPVNRRQ
MFDFQGLIPGYTPTAVDSPLQKRSFAELSMIGQASISGSEDITASPQLSKEDALNLSVPR
QRRRRRRKIEIEAERAAKRRNLMEMVAQLRESQVVSENGQEKVVDLSKASREATSSTSNF
SSVTSKFILPNVSTPVSDAFKTQMELLQAGLSRTPTRHLLNGSLIDGEPPMKRRRGRRKN
VEGLDLLFMSNKRTSLTVEDAEVTKAFEEDMEALPARNIPSPGQLDPDTRIPVINLEDGT
RLVGEDAPKNKDLVEWLKLHPTYTVDMPSYVPKSADVLFSSFQKPKQKRHRCRNPNKLDI
NTLTGEERVPVVNKRNGKKMGGAMAPPMKDLPRWLEENPEFAVAPDWTDIVKQSGFVPES
MFDRLLTGPVVREEGASRRGRRPKSEIAKAAAAAAAVASTSGINPLLMNSLFAGMDLTSL
QNLQNLQSLQLAGLMGFPPGLATAAAAGGDAKNPAAMLPLMLPGMAGLPNMFGLSGLLNN
PITATTGNATTASGQGETEDGASKAEEKKNENEEENKDSEKSTDTVSATDSANGSVSAAT
AATTATATTTTTTNTGLPTNPLAFNPFLLSTMAPGLFYPSMFLPPGLGGLTLPGFPALAG
LQNAVGSNEEKATDKTEGTAFKDEENLEGSDAEESLDKTADSSILEDEIAQGEELDSLDG
GEEIENNENDE
NT seq 9036 nt   +upstreamnt  +downstreamnt
atggcagatccaggaatgatgagtctgtttggagaagatgggaatattttcagtgaaggg
ctggaaggtctcggagaatgtggatatcctgaaaacacagtaaatcctatggggcagcaa
atgcccatggatcaaggatttccctctttacagtcatctcttcatcatccccctgcaaat
caaaatcaagcgaagttgacccattttgatcactataatcaatacgaacagcagaaaatg
cacctgatggatcagccgaacaggatgataagcaatgcccctgggaatggtatagcatct
cctcattcacagtatcacaaccctcccgttcctcaggttcctcatggcagcggtgctagt
ggtcagatgggagtctatcccagcatgcagaacgaaagacacgggcaacccttcgtagac
agtggctcgatgtgggggccgcgggcagttcaagtgccagaccagataagagcaccatac
cagcagcagcagcaacagccgcaaccgacacagccgccacaagcgccctccggacccccg
gggcagggccatcctcagcacatgcagcagatgggaaactacatggctcgtggtgatttt
tcaatgcaacagcacggtcagccgcaacagcagaggatgaaccagttttctcaaggccaa
gaaggcctcaatcagggaaaccctttcattgccacctcaggacctggccacttgtctcat
gtgccccagcagaatcccagtatggcaccttctttgcgacactctgtccagcaatttcac
caccatccccccactgctctccatggagaatcagtagcccacagccccagattctcccct
aatcctccccagcagggtgctgttaggccgcaaacacttaattttagttctcggagccag
acggtaccctcacctactataaacaactcagggcagtattctcgatatccttacagtaac
cttaatcagggattagttaataatacagggatgaatcagaatttaggccttacaaataac
actccaatgaatcagtctgtaccaagatacccaaatgctgtaggatttccatcaaacagt
ggtcaaggactaatgcaccagcaacccatccaccctagtggctcacttaaccaaatgaac
acgcaaactatgcacccttcacagcctcagggaacttatgcctctccacctcccatgtca
cctatgaaagcaatgagtaatccagcaggtacgcctcctccacaggttaggcctggtagc
gctggaataccaatggaagttggcagttatccaaatataccccatcctcagccatcacac
cagccccctggtgccatgggaattggacaaaggaatatgggcccccgaaacatgcaacag
aatcgtccttttatgggtatgtcttcaacaccacgggagatgggtgggcacatgagacca
aatggttgtccaggtgttggccttgcggatccacaagcaatacaagagcgactaatatct
ggccagcagcttcctagtcaacagcagtcttttcaacagcaaatgccaacctgtcctccc
atgcagcctcatccagggatacatcatcagtcttcaccgccgccacatcctcatcatcag
ccttgggcacagcttcaccagtcaccacaaaacacaccgcaaaaagtgcctgtccttcag
cattctccatcggaaccttttttagagaaaccagtgccggatatgactcaggttagtgga
ccgaatacccagctagtgaaaagtgatgattatctgccatcagttgaaccacagccccag
caaaagaaaaagaaaaagaaaaacaatcacattgctgcagaaggtcccagtaaaagtttc
ggtaaggaagactttcctgggggacttgacagccagaatctaagcaggaactcagtggat
tgctcccaagaggataaaaagaaaaagaaaaagcccaaggcaaaaaaagaaccgaaggat
cctaaagagcccaaggaaaagaaggaacccaagacccccaaagtccctaagacccctaaa
gagccaaaggaaaagaaagcaaaaaacaccacgccaaaacccaagaccagcaaaaagaca
agtaacaagaaaacagattcagaaagtagtgctgcgaagaaaaaggttaacaagggaaag
gaaggttctgaaaactcagatttggataaaactccaccaccttcacctcatcctgaagat
gaagatgatccaggagttcagaagcgacgctccagcaggcaggtgaagaggaaacgttat
acggaagacttggagttcaagatttcagatgaggaggcggatgatgctgatgctgctgga
agagactctccttcaaatacttctcagtcagagcaacaggagtctgctgatgctgaaggt
cctgttgtggagaaaatcatgagtagccgctcagtcaagaaaaagatggagaatggagag
gaggtagaaatagaggagttctatgtaaagtacaaaaacttttcttaccttcattgtcag
tgggcatctgtggaagagctggacaaagacaagagaattcagcagaagattaagcggttt
aaggcaaaacagggccagaacaaattcctttcagaaattgatgatgagctttttaatcca
gattatgtggagatcgatcgaatcttggatttttcacgtagcacagatgataatggggag
cctgtaacgcattatctggtgaagtggtgttcgcttccttatgaagacagcacttgggag
ctcaagcaagacatcgaccaagctaagattgaagaatttgagaaactgatgtctagagag
ccagaaatggagcgtgtggagcgacctcctgccgatgactggaagaaatcggagagttcc
agggagtataaaaacaataacaaactcagggaataccagttggagggagtaaactggctt
cttttcaattggtacaacacacgaaactgcattttagcagatgaaatggggttgggaaag
actatccagtccattacgtttctctatgagatatatttgaaaggaatccatggtcctttc
ttggttattgcaccgttgtccacaattcccaactgggaaagggagttccgcacctggaca
gagttgaatgtggttgtgtatcatgggagtcaagcaagccggcggaccattcagttgtat
gaaatgtatttcaaagatccacagggtcgtgtgataaaagggtcctacaagttccatgct
attatcacaacatttgaaatgattttgactgactgccccgagcttcgaaacattccatgg
cgttgtgtagtaatcgatgaggcccacaggctgaaaaacaggaattgtaagcttttggaa
ggactcaagatgatggatctggaacataaagtgctgcttaccggaactcctttgcagaat
acagtagaagagctatttagcttgcttcactttttggaaccaggtcgcttcccatccgaa
accacattcatgcaagaatttggggatctgaaaaccgaagaacaggtgcagaaattgcaa
gctattttgaagccgatgatgctgagacgtctcaaggaggatgtggaaaagaacctggcc
cccaaagaggaaaccatcattgaagttgagctgacgaatattcagaagaagtactatcgt
gctattctcgagaagaattttgcgtttctctcgaagggtggaggtcaggcaaatgtacct
aatcttttaaacactatgatggaactaagaaaatgctgcaatcatccgtaccttattaat
ggtgctgaagagaaaattttggaagagtttaaagaaacacacaatgccgactctccagat
tttcagctccaggcaatgatccaggctgctggcaagctagtactgattgacaagctgctg
ccaaaactgaaggctggtggccacagggtgcttatcttttcccagatggtgcgctgcttg
gacatactggaagactacctcattcaaagacggtacccatacgaacgaattgatggccga
gtaagaggcaacttgcgtcaggcagctattgacaggttttcaagacctgattctgatagg
tttgttttcctgctgtgtacaagggcaggaggcttgggcattaatcttactgctgctgat
acctgcatcatttttgattcagactggaaccctcaaaatgacctccaggctcaagcacga
tgtcacagaataggacagagcaaatcagtgaaaatttacaggttgattacaaggaattct
tatgaaagggaaatgtttgacaaagctagcttgaagcttggccttgataaggctgtgcta
caatctatgagtggaagagaaaatgctacaaatggggtgcaacagctttctaaaaaagaa
atagaagatcttcttcgaaagggagcatacggtgctctgatggatgaggaagatgaaggg
tctaagttttgtgaagaagatattgatcaaattctcttaaggcgaacacacacaattact
attgaatctgaaggaaaaggctcaacatttgcaaaggctagttttgttgcatctgggaac
aggacagacatttccttggatgaccctaatttttggcagaagtgggcaaagaaggctgaa
ctggatattgatgctttaaatggaaggaataacctagttattgatacaccaagagtaaga
aagcaaaccagactctacagtgcagtcaaagaggatgaactgatggagttttcagacctg
gaaagtgattccgaagaaaagcctagcacgaagccccgtaggcctcaggacaaatcacag
ggttatgcaagaagtgaatgtttcagggtagagaagaacttgttggtttatggctggggt
cgttggactgacatcctctcacatgggcgctataaacgtcagctaacagaacaagatgtg
gaaaccatctgccggactatcctggtatattgccttaatcattacaaaggggatgaaaat
atcaaaagtttcatctgggatctgatcactccaactgcagatgggcaaactcgagctttg
gttaatcattccggcctgtctgcgccagtgcccagagggaggaaaggcaagaaagtaaaa
gcccagagttcacagccaatgcttcaagatgctgattggctcaccacctgtaatccggat
gtattatttcaagaagacagctatagaaaacatctcaaacatcattgtaataaggtcctg
ctgcgtgtccgcatgctgtactatctacgacaagaagttataggggaccaagcagacagg
atcttagagggtgctgactcaagtgaagtagatgtatggatacctgagccgttccatgct
gaagttcctgcagactggtgggataaggaggcagataaatcccttttaattggagtattc
aaacacggttatgagaagtacaattccatgagagctgattcaacactgtgctttctggaa
cgggttggcatgcctgatgcaaaggccatagctgctgaacagagagggacagacatgtta
gcagatggcggtgatggaggtgaattcgacagagaggatgaagatccagaatataagcca
accagaactcctttcaaggatgaaattgatgaatttgcaaactcacctccagaagacaaa
gaggagtccattgaaatccacccaaacaagcacagtgaaagcaattctgagttaggccaa
ctctactggcccaacacttcaaccctgactacccgtctgcgtcgcctcattactgcctat
cagcgcagctataaaaggcaacaaatgaggcaagaggcactaatgaagactgaccgcagg
agacgtcggcctcgggaagaagtgagggcactagaagcagaaagggaggctataataact
gaaaaacgacaaaaatggacaagaagagaagaagccgatttttatcgtgtagtgtctact
tttggaattatttttgatcctataaaacatcaatttgactggaatcaattccgagcattt
gccaggcttgataaaaagtccgatgaaagcttggagaagtattttaatggctttgtgaat
atgtgtagacgagtgtgccgaatgccagtcaagccagatgatgagccacctgatctttct
actatgattgaaccgatcacagaagaacgtgcttccagaactttatatcgcatagagctg
ttacggaaaatccgtgaacaggttcttcatcacccgcagctgggagagaggctaaaactt
tgccaaccaagtttggatctgccagagtggtgggagtgtggtaaacatgacaaagactta
ctgattggtgctgctaaacatggagtcagtaggacagattatcacattctgaatgatcct
gagctgtcttttcttgaggcccacaaaaactttgctcaaaacagggggacgggtaatgca
aatactgtctcttctctacaccctgtgggtgctggctgcagtcaaacaccacctattgtc
ccatccacaccagtgcaagaagaaaaaagcacagaacaaacggagtctaaagttgaagga
tctgaaaatccagcagccaaagaaaagtctgatatcaaggaagagacagatattgcagat
aaagacactaaacaggactgtgatgctgaggctgagactggctctgttaaatgtgaattg
aaagacatagaaatgagtacagacgtggacccaaaatctatttcggaaaaaggttcagaa
gaagatgaagaggagaaactggatgatgatgacaaatcagaagagtcctcccaacctgaa
gcaggagcagtttctcagggtaagaattttgatgaagaaagcaatgcctctatgagtacc
gcaagggatgaaacacgcgatggattctacatggaagatggggatccttctgtggtccag
ctgcttcatgaaagaacatttgccttttctttctggcctaaggaccgagtaatgatcaac
cgattagacaacatctgcgaagcagtgctgaaagggaagtggccagtaaataggcgccag
atgtttgatttccaggggctcatacctgggtatactccaacagctgtggacagccctctg
caaaaaaggagctttgcagagctctccatgattggtcaagccagcatcagtggcagtgaa
gacatcactgcttctcctcagttgtcaaaggaagatgcactcaatttatcagttccacgt
cagaggaggaggagacgaagaaagattgaaattgaggctgagagagctgccaaaaggaga
aatcttatggaaatggttgcccagttacgtgagtctcaggtggtctcagaaaatggacaa
gaaaaggttgtagatttatcaaaggcctcacgagaggcaacaagttctacctcaaatttt
tcatctgttacttcaaagtttatcttgcctaatgtctccacacccgtgtctgatgccttt
aaaactcaaatggagctgctgcaagcaggtctttcacgcacacccacaaggcatctacta
aatggctctttaatagatggagaaccgcccatgaagaggaggagaggaaggaggaaaaat
gtagaagggcttgatctgttatttatgagcaacaaacggacatcattgacagtagaggat
gcagaagtgaccaaagcttttgaagaagatatggaggccctaccagcaaggaacattcca
tctcctggtcaactggacccagacactcgcatccctgtaatcaatctagaggatgggacc
aggctggtgggagaagatgctcccaaaaacaaggatttagttgaatggcttaaattgcat
cctacttacactgtagatatgccaagttatgtaccaaagagtgcagatgtgctgttttcc
tcatttcagaagccgaaacaaaaacgacacagatgtcgaaaccctaataaactggatata
aacaccttgacaggagaagaaagggtacctgttgtaaataagcgaaatgggaagaagatg
ggtggagctatggcccctccaatgaaggacttgccaagatggttagaagaaaatcctgaa
tttgctgttgctccagattggactgacattgttaaacagtctggttttgttccagagtct
atgtttgaccgtcttctcactggacctgttgtgagggaggaaggagcaagcagaagagga
agaaggccaaaaagtgaaattgccaaagcagctgcagcagctgctgctgtagcatcaact
tcgggaatcaacccactactaatgaacagtctgtttgctggaatggacctcaccagcctc
cagaacctacagaacctgcagtctctccagctcgcaggcctcatgggctttccgccaggg
ctagcaacagctgctgctgctgggggggatgctaaaaatccggctgccatgttgcctctg
atgttgccagggatggcaggattgcccaatatgtttggactaagcggattgttgaataac
ccaataacggctactactggaaatgccactactgcttccggtcaaggagagactgaggat
ggcgcttcaaaagctgaagagaagaaaaatgagaatgaagaggagaacaaagactctgag
aaaagcacagacactgtttctgctactgactctgcgaatggatctgtcagtgctgctact
gcggcgactaccgccactgccaccactaccaccaccaccaacactggattgcccacaaac
cctctggccttcaatcctttcctgctgtctaccatggctcctggcctgttctatccatct
atgtttctacctccgggactgggaggattgactctgcctggtttcccagcactagcagga
cttcagaatgcagtgggctccaacgaagagaaggctactgacaaaactgaaggaactgcc
tttaaagatgaagaaaacctggaaggcagtgatgcagaggagagccttgataaaactgca
gattcctccattttagaagacgaaatagcacagggtgaagaattagactcacttgatggg
ggggaagaaatagaaaacaatgaaaatgatgaataa

DBGET integrated database retrieval system