KEGG   Gallus gallus (chicken): 421177
Entry
421177            CDS       T01006                                 

Gene name
ELF3
Definition
(RefSeq) ETS-related transcription factor Elf-3
  KO
K09429  E74-like factor 3
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    421177 (ELF3)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    421177 (ELF3)
SSDB
Motif
Pfam: Ets SAM_PNT
Other DBs
NCBI-GeneID: 421177
NCBI-ProteinID: XP_419257
CGNC: 382
Ensembl: ENSGALG00000000616
UniProt: E1C6L3
Position
26
AA seq 371 aa
MAASCEISNIFSNYISAMYQPEEVQLPPDVLGRPGEDSGMGLSLSTSQPLAEGTDKPEWF
SELPYFWTKVQVLEWISYHVEKNKYDASSIDFSCCNMDGHALCHCTRDQMRLIFGPLGDE
LYDRLHEITSDELSWIIELLEKEDANSQETFLDSSHLELGNPCAKDSLEDLKPTNPFLAT
DFTCLPGAMSPGSSDLSGPVMSHSPNSQDSGGSDLDLDPMEAKLFPEDGFAGSKKGDGKH
GKRKRGRPRKLSKDSRECLEGRKSKHSPRGTHLWEFIRDILIHPELNEGLMKWEDRREGV
FKFLRSEAVAQLWGQKKKNSSMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNSSGWK
EEEVLNRNKEL
NT seq 1116 nt   +upstreamnt  +downstreamnt
atggcggcatcttgtgagatcagcaacatcttctccaactacatcagcgccatgtaccaa
cccgaggaggtgcagctgcccccggacgtgctaggacgccccggggaggacagcggcatg
gggctgagcctctccaccagccaacccctggcagagggcacagacaagcctgagtggttc
agtgagctcccatacttctggaccaaggtgcaggttctggagtggatcagctaccatgtg
gagaagaacaagtacgatgccagctccattgacttctcctgctgcaacatggatgggcac
gcgctctgccactgcaccagggaccagatgcgcctcatctttgggccactgggggatgag
ctgtatgaccgcctgcatgagatcacctccgatgagctgagctggatcatcgagctgctg
gagaaagaggatgcgaattcccaagagaccttcctggacagcagccacctggagctcggc
aatccctgtgccaaggactccctggaggacctgaagcccacaaaccccttccttgccaca
gacttcacctgcttgcccggtgccatgtcccctggcagctccgacctctcagggcccgtg
atgtcccacagccccaattcccaggactccggtggaagtgacctcgacctcgatcccatg
gaagcaaagctctttcctgaggatggctttgcaggcagcaagaaaggggatggcaaacat
ggcaagcggaaacggggccggccccgaaaactcagcaaggacagcagagagtgcctggag
ggtcggaagagtaagcactccccacgaggaactcatctgtgggagttcatccgtgacatc
ctgatccaccccgagctgaacgaggggctgatgaagtgggaggaccgacgtgagggcgtc
ttcaagttcctgcgctccgaggcggtggctcagctctgggggcagaagaagaagaacagc
agcatgacctacgagaagctgagccgagcgatgcgatattactacaaacgggagatcttg
gagagggtcgatgggcgccgcctggtctacaagtttgggaagaactccagtggatggaag
gaggaggaggtgctcaacaggaacaaggagctgtag

DBGET integrated database retrieval system