KEGG   Gallus gallus (chicken): 421297
Entry
421297            CDS       T01006                                 

Gene name
ALK
Definition
(RefSeq) ALK tyrosine kinase receptor isoform X1
  KO
K05119  anaplastic lymphoma kinase [EC:2.7.10.1]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    421297 (ALK)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:gga04090]
    421297 (ALK)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     421297 (ALK)
Protein kinases [BR:gga01001]
 Receptor tyrosine kinases (RTK)
  ALK family
   421297 (ALK)
CD molecules [BR:gga04090]
 Proteins
  421297 (ALK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase
Other DBs
NCBI-GeneID: 421297
NCBI-ProteinID: XP_025004683
CGNC: 6869
Position
3
AA seq 671 aa
MDGEDGVSFINPIGTLYTPALKVTEGHGEVDIRLHLNCSHCEMDECRVDLETQKVICFCE
PGTDLAEDGVSCIAEPTVHLPLSLVLSVVTSALVAALILAFSGIMIVYRRKHQELQAMQM
ELQSPEYKLSKLRTSTIMTDYNPNYCFAGKTTSISDLKEVPRKNISLIRGLGHGAFGEVY
EGQVAGIPSDPTPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQALP
RFILLELMAGGDLKSFLRETRPRPNQLSSLSMLDLLHVAHDIACGCQYLEENHFIHRDIA
ARNCLLTCRGPGRVAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTD
TWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTNGGRMDPPKNCPGPVYRIMTQCWQHQPE
DRPNFAIILERIEYCTQDPDVINTALPVEYGPSIEEEEKVAIRPEDPEGIPPLLVSSHQD
KKDDKQTLPSPPPLPSAITAGKALGKAGSLELSVPGKVQAASGGGHINMAYAQSNPPSEL
HKSRGSRNKPTNLWNPTYGSWFAEKQASKNKPLLEKEMPERENLGHEGNCTVGPNIVTGR
LPGSSLLLEPSSLTASVKEVPLFRLRHFPCGNVNYGYQQQGLPLEASTPPCATSYEDPAL
RNKNHISQQGP
NT seq 2016 nt   +upstreamnt  +downstreamnt
atggatggggaggatggtgtgtcctttattaatccgattggtactttatacactccagca
cttaaagtgacagaggggcacggagaggtggatattaggctgcaccttaactgcagtcac
tgtgagatggacgagtgccgtgttgatcttgagactcaaaaagtcatttgcttttgtgag
ccaggcacagacttggctgaggatggtgtgtcttgcatagctgagccaacggtccatctc
cctctctccttggttttgtcagtagtaacttcagcattggttgctgccttaattttggct
ttttcaggaatcatgatagtgtatcgtcggaagcaccaggagctacaagccatgcagatg
gagttacagagcccagaatacaagctaagcaagctgcgtacctccactattatgacagac
tacaatcccaactactgctttgcaggaaagactacatccattagtgacctcaaagaggtg
cctcgcaaaaacatctccctcatccggggtttgggccacggagcctttggtgaggtatat
gaaggtcaggtggcagggatccccagcgaccccactcccttgcaggtggctgtgaaaaca
ttgcctgaagtgtgttcagagcaagatgagctggacttcctcatggaagctctcattatt
agcaagttcaatcaccagaatattgtgcgttgtatcggagtgagcttgcaggcgctgccc
cgtttcatcttgttagagctcatggctggaggtgacctcaaatcgttcctgagggagacg
cggcccagaccgaatcagctttcctccctctccatgctggacttgctccacgtggctcat
gacattgcttgtgggtgtcagtacctggaggagaaccacttcattcacagggatattgct
gctaggaactgcctccttacctgtcgagggcctggaagagtggctaaaattggagacttt
ggcatggcccgggatatatacagagccagctactatcggaagggagggtgtgcgatgctg
cctgtcaaatggatgcctcccgaggctttcatggaagggatatttacatcaaaaacagac
acatggtcctttggcgtattgctgtgggagatattctcattgggatacatgccttatcct
agcaaaagtaaccaggaggttctggagtttgtaaccaatggaggaaggatggatccacct
aaaaactgcccaggccctgtataccgcattatgacccagtgctggcagcaccagccggaa
gacaggccaaactttgccataatcctggagaggatcgagtactgcactcaggacccagat
gtcatcaacactgctttgccagtagaatatggcccgtcgattgaagaggaagagaaggta
gcaatacgcccagaagatccagaaggaattcctcctctcttggtttcctcgcaccaagac
aaaaaggatgacaagcaaaccctgccatctccaccacccctgccatcagccatcactgca
ggaaaagctctagggaaagcaggatccttggagctgtcagtccctgggaaggtgcaggca
gcctcaggtgggggacatatcaacatggcttatgcccagtccaatcccccttctgagctg
cacaaaagcaggggctccaggaacaagcctaccaacctctggaatccaacgtatggttcc
tggtttgccgagaagcaagccagcaaaaacaaacctctgctggagaaagaaatgcctgag
agggagaacttgggacacgaaggaaactgtactgtggggcccaatatagtgactggcagg
ctaccaggctcctccctgctattagagccatcttccctaacagcaagcgttaaagaagtg
cctctctttaggctccgtcacttcccctgtgggaatgtcaactatggataccaacagcag
ggcttgcctttggaagcctccacgccaccttgtgctaccagttacgaggaccccgccctt
agaaacaagaaccacatatcccagcaggggccctga

DBGET integrated database retrieval system