KEGG   Gallus gallus (chicken): 421301
Entry
421301            CDS       T01006                                 

Gene name
LBH
Definition
(RefSeq) protein LBH
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: Lbh
Other DBs
NCBI-GeneID: 421301
NCBI-ProteinID: NP_001026209
CGNC: 51464
Ensembl: ENSGALG00000009052
UniProt: Q5ZM46
Position
3
AA seq 106 aa
MSVLCPLPCPDYLRSAEMTEVMMSTPAMDEIGLSPRKDGLSYQIFPDPSNFDCYCKLKDR
LPSIVVEPTEGDVESGELRWPPEEFLVQEEEEEESCEDAKEDNKEQ
NT seq 321 nt   +upstreamnt  +downstreamnt
atgtctgtgctttgtcccctgccctgccctgattacctgagatcagccgagatgaccgaa
gtgatgatgagcaccccggctatggatgagatcggactcagcccccgtaaagatgggctc
tcgtatcagattttccctgatccctctaactttgactgttactgcaagctgaaggaccgc
ctgccctccatcgtggtggagcccacggagggtgatgtggagagcggggagctgagatgg
ccgcctgaggagttcctcgtccaggaggaggaagaggaggaaagctgtgaagatgcaaag
gaggacaacaaggagcaataa

DBGET integrated database retrieval system