KEGG   Gallus gallus (chicken): 421337
Entry
421337            CDS       T01006                                 

Gene name
MIA3
Definition
(RefSeq) melanoma inhibitory activity protein 3 precursor
  KO
K23704   
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: NPIP SH3_2 YabA KELK
Other DBs
NCBI-GeneID: 421337
NCBI-ProteinID: NP_001264487
CGNC: 51470
Ensembl: ENSGALG00000041034
UniProt: A0A1L1RP17
Position
3
AA seq 1994 aa
MAAAAPPDPRLLLAVLLLLPPPGPLCAAGPELSRRFTERKRCADPECSKLMCRGKAMKDF
QGPDCRFVNFKKGETVYVYYKLIGMSTELWAGSIGSDFGYFPKDLLEINHNYTNEELELP
TEETDFVCFQDGRDDFDNYNVDELLKSSEETIANERDSESSDPGTKPAGTTEGDEEEGKV
DTIEFHDTLESDNLELTTQEDKEALAVTEEVDSSLKEGTASAGINPTVNSHEEISQGEQI
AHEHLQGMLNENLKGLESENTKNSSIPQGETSQFDKESEEVNAYTLLNRELSVNLKTKFG
STADAIVSDDEVTRLVTSMENDFNEDLSNNAYDAEEESDFVDQFEEIPLLSFMTEEESVS
LVDSEADESNGFESKHHKLDEYANGATELHNQRDNEEERDSDVLITKDAFSENKNSGDSV
NVDMFESEQTKEKRDEAMPVSKKEAPTATQLDDLSEELSRREPVGASDPDAKEKTNKTEQ
FEEQLLTDETVLHPEELKSTAVPDPRVLHSPGDGLKFKSFVEGKQDALSPPAGDVNQSPE
GVLLAETEKEEEKFGGDTLKESSENNFKHRKLWEKMKEKGKAKYEPSGDVLAKPVEDVQN
ASQSDAGDTDLLKDKLEQEMPVVEKEILRQEEDLKQTREADHENQRPISVKKKPEIERGS
MKETSADERDPSRRGAAEQPRPWENETEYSEADVKEELSRNLGKMTIFEERIEKSSPEEK
SKSAAQNTNAENSTQQGTAHTDNEDSDRNLGTSSARETTLRLELQSEEPDAEEDPDLKQE
EELLEDENAASAKLLQARLANIQGNAQTTRSTNPDLGVLSEAVSGTVNPTYETGEKTNSF
SEDTKEISRVQDAHEVGNKEVDKPVSEDTKLDEIEHVIEDNKESSEAEEPSAVEEYDFKS
PDREDSNDFNQRKGHLPESILLGDSEEIQNSEDTRNAHQHSAHFPSPADMSAATNDTVTD
YSESVKRLTITRDFLDEKRVIRLQKYLGLQNVIRIEAMFQDMKIEMELARKASQNNEEIE
KALDQILKSSDSSIMDVVGKVLDSRVAENQEEVVKEMDLYDEESALMDDIQELIYSLRSK
YSSASESVPLGSFLEQEEDQLHVQGAAKEAENDAAPGRNLHGIDESSQKFQQLEDKRPFL
PMEEEAEEEETAVNIPPEDEEATFSDNKEAEDGYGSERGLPLADPFGAADAGESAKGDTA
PDHVPGVPPSLPPDPGAVPPGGGASEGALSGAVRRLLRQLAATLPEDIRPGPDFHGLPWE
PVIVTALVGMATLAIIFWRTCLSVKSRMYQVTEKQLAEKIQNLLQEKTEMLDKFSECDEK
IKQAKESMKVAQEQKSILSDEIAGLKDTVKELEETNHQLDDKIKSLRTMLDTERKQNAKK
QKKLSETQKSLEKFEEAFSMHSAELSEVQIALNESKLSEEKVKAELQHVQEENARLKKSK
EQLLKEAEGWSERHTELTEQIKLYRKSQKDIEEALAYKENEIEVLTNCIMQLKQLDTDSA
SEAKDGEGLEWSTKDDLANGELPDNEKMKTQIKQMMDASRVKTMLSLVEEDRNSLQSKLS
DEVAARHELEEQIKKLEHDSSSLQSAKARLENECKTLQQKVEILGELYQQKEMALQKKLT
QEEYERQEKEQKLSAADEKAVLAIEEVKVYKQRIQDMEEELQKTERSYKNQIAAHEKKAH
DNWLIARSAERALAEEKREAANLRQKLMEVNQKTIMLQRPLIVKPTPGRPDRQVPPRRVP
LSRDGSFGPSPVSGGNPSPTQMMEVPSRPLSAPQREGSRAEFGTVVDGPPAPRRPPELPG
RMSVPDLGPAVASLISSGPRTSSPATAKDRAVNVGPKGPPSFPGTPVMTSPVLGPPPPPP
VNYGPPPAPFPGHYGPGPRPLPVPLVCGAPLPPPAARDFLPGPSLGIRDLPPGPLPPLPD
PRSYRRGHPHFRPPGPPGPRDYPPGPPLPPPASRDYAPSRSRDLPPAGPRDYPAGPAPPP
AGSKDYAQPPVQKP
NT seq 5985 nt   +upstreamnt  +downstreamnt
atggccgcagcggcgccgccggaccctcggctgctcctggccgtgctgctgctcctgccg
ccgccgggccctctctgcgccgccgggcccgagctgagccgccgcttcaccgagcgcaag
cgctgcgccgaccccgagtgcagcaaactaatgtgccgagggaaagcaatgaaggatttt
caaggtccggactgtcgctttgtaaattttaagaaaggagaaacagtatacgtgtattac
aaactaataggaatgtcaactgagctttgggctggaagtattggaagtgattttggatat
tttccaaaggatttacttgaaataaatcataattataccaatgaggagctagagttacca
acagaagaaacagactttgtttgctttcaagatggaagagatgattttgataactataac
gtggatgaacttctgaagtcatcggaagagacgatagcaaatgaaagggactctgaatca
agtgatccagggacaaaaccagctggaacaactgaaggagatgaagaggagggaaaggtt
gatacgatagagttccatgatactttggagtcagacaatcttgaactaactacacaggaa
gataaggaagcccttgctgtgacagaggaggtagacagttctcttaaagaaggaactgca
agtgctgggataaaccccactgttaatagtcatgaagaaatctctcagggagaacaaatt
gcacatgagcacttacaaggaatgttaaatgagaatctaaaagggctagaaagtgaaaat
accaaaaactctagtattcctcagggtgaaactagtcaatttgacaaagagagtgaagaa
gtcaatgcctatacacttttaaacagagagctctctgtgaacttgaaaacaaaatttggc
tcaactgctgatgctattgtatcagatgatgaagtgactcgcctcgttacatcgatggaa
aatgattttaatgaagatttgagcaataatgcttatgatgcagaggaggagtcagacttt
gtagatcagtttgaagaaattcctttgctgtcatttatgacagaagaagaaagcgtatcc
ctagtggattcagaagctgatgaaagcaatggctttgagtcaaaacatcataaacttgat
gaatatgcaaatggtgctacagagctacacaaccaaagagacaatgaggaagaacgtgat
tcagatgtgttaattactaaggatgccttcagtgagaacaagaactcgggtgatagtgta
aatgtggacatgtttgaatctgaacaaacaaaggagaagcgtgatgaagcaatgccagtt
agcaagaaagaagcaccaacagcaactcaacttgatgatctctccgaagagctcagtaga
agagaacctgtaggtgcaagtgacccagatgcaaaagaaaaaacaaacaaaactgaacag
tttgaagagcagctcctgactgatgaaacagtgttgcatcctgaagagctgaagagtaca
gctgtgcctgatccccgtgttttgcatagtccaggagatggtctgaaattcaaatcattt
gttgaaggtaagcaagatgctctaagtccacctgctggtgatgtgaaccaaagtccagaa
ggagtgctacttgctgaaacggagaaagaagaggaaaagtttggaggtgacaccttgaag
gagagctcagaaaataattttaagcacagaaagttatgggagaaaatgaaggagaaagga
aaagctaagtatgagccttctggtgatgttctagcaaaaccagtggaagatgtacaaaat
gcatctcaaagtgatgcaggagatactgaccttctgaaagacaaactggagcaagaaatg
cctgtggtggaaaaagaaatcctaagacaggaagaagatttgaaacaaacaagggaggct
gatcatgaaaatcaaaggcccatctctgttaagaaaaaaccagaaatagagaggggaagc
atgaaagaaacctctgcagatgagagagacccaagccgtagaggagctgctgaacaacct
aggccatgggaaaatgagactgagtattcagaggcagatgtgaaagaagagctttcaaga
aatcttggcaagatgacaatatttgaagaaagaatcgagaaaagttcccctgaagaaaaa
tcaaaaagtgctgcacagaatactaatgcagagaattctactcagcaaggaactgctcat
actgataatgaagactcagacagaaatcttggcacaagttcagctagagaaacaacccta
aggctagaattgcagtctgaagagccagatgctgaagaagaccctgacttgaagcaagag
gaagaactactggaagatgaaaatgctgcaagtgcaaagctgttgcaagcaaggcttgca
aatatacagggaaatgctcagacaactagaagtacaaatcctgatttaggagtactgagt
gaagctgtttcaggaactgtaaatcctacttatgaaacgggagagaaaacaaactcattt
tctgaggacactaaagaaataagcagggtgcaggatgcgcatgaggtcggaaacaaagag
gttgacaaaccagtgagtgaagataccaaattagatgagattgaacatgtcatagaagac
aacaaagagtcttctgaagctgaggaaccatcagctgtggaagaatatgatttcaaatct
cctgacagagaggacagcaatgactttaaccaaaggaaaggccatctcccagagagcatt
ttgctgggagattcagaagagattcaaaattcagaggatacaagaaacgcccaccagcat
tctgcacatttccccagccctgctgacatgtcagcagccacaaatgacactgtaacagac
tacagtgagtctgtgaagcgactcacaataacaagagatttccttgatgaaaagcgtgtg
atacgcctacagaagtaccttgggctccaaaatgtgattaggattgaagccatgtttcag
gacatgaagatagagatggagcttgctcggaaggcaagccagaacaatgaagaaatagaa
aaagctttggaccagatacttaagtcttcagactcgagcattatggatgttgtaggaaag
gtcctggattccagagtggcagaaaatcaagaggaggtggtgaaagaaatggatttatat
gatgaagaaagcgcactgatggacgatattcaagaattaatatactctttaagaagtaaa
tactcatctgctagtgagagtgtcccacttggttcttttctagagcaggaagaagatcag
ctgcatgttcaaggtgctgcaaaagaagctgaaaatgatgcagctcctggcagaaaccta
catggcattgatgagagcagtcagaagtttcagcagcttgaagacaagaggccatttctt
cctatggaggaggaggcagaggaggaggagacagctgttaatattccacctgaagatgag
gaggccaccttctcagataacaaagaagccgaagatgggtacggcagtgaaagaggattg
ccgctggctgatccctttggggcagctgatgcaggagagagtgctaagggagacactgct
ccagaccacgttccgggtgtccctccctccctccctccggaccccggcgccgtgccgccg
ggaggcggcgcctcagagggagcgctgagcggggcggtgcgccgtttgctgcgccagttg
gctgccaccctgcctgaggatattcgtcctgggcctgatttccatggcctgccgtgggag
cccgtcattgtcactgccttagtggggatggccacgcttgctatcattttctggagaacc
tgcctttcggtaaagagtagaatgtatcaagtgactgaaaagcaattggctgagaagatt
caaaacctcctacaagaaaaaacagaaatgttagacaagttttcagagtgcgatgaaaag
ataaagcaagcaaaggaatcgatgaaagtggcccaagaacaaaaaagcattctctcagat
gaaattgcagggcttaaggacactgtcaaagaactagaagaaacaaatcatcagctggat
gacaaaataaaaagcctgcgcacaatgcttgacacagagagaaaacagaatgccaagaaa
cagaaaaaactctctgaaacccagaagtcattggagaaatttgaagaggccttcagcatg
cattctgcagagctgtcagaggtgcaaatagcccttaatgaatctaaactaagtgaagaa
aaggtgaaagcagagcttcagcatgtgcaagaagagaatgctaggctgaaaaagagcaaa
gagcaactgctaaaagaagctgaaggttggagtgagaggcacactgagctcactgagcag
atcaaactgtatcggaagtctcagaaggacatagaagaagcacttgcctacaaggaaaac
gaaattgaagttttaactaactgcattatgcagctgaagcaacttgacacagattcagca
tctgaggccaaggacggtgaagggcttgaatggagcacaaaagatgatctggccaacgga
gagttgccagataatgagaagatgaagactcagattaagcagatgatggatgcctccagg
gtaaaaactatgctatctctagttgaagaagacagaaattctctgcagtccaagctgagt
gatgaagtagcagcgagacatgagctggaggagcaaataaaaaaattagaacacgactcc
tcttcactgcagtcagccaaagctcgactggaaaatgaatgtaaaacactacaacagaag
gtggagattcttggtgaactttaccagcagaaagaaatggcactccagaaaaagctaact
caagaagaatatgagcgccaggagaaggagcagaagttgtctgccgcagatgaaaaggcc
gtgctggctatcgaggaagtgaaagtttacaagcagaggatccaagatatggaagaggaa
ttgcaaaaaacagagagatcttataaaaaccagattgctgctcatgagaaaaaagcacac
gacaactggcttattgcccgctctgctgagagagctctggctgaagagaagagagaagca
gccaacctgagacagaaattaatggaagtgaaccaaaaaaccatcatgcttcaaagaccg
ctaattgtaaagccaactccaggcaggcctgatcgccaggtcccaccacgacgagtgccc
ttaagtagagatggttcttttggtccatcgcctgtgagtggaggaaatccatcacccaca
cagatgatggaagttcccagtaggcccctttctgctcctcagagagaaggctcaagagct
gaatttggtacagtggtagatggcccccctgctccacggaggccaccagagctccctgga
aggatgtccgttcctgatcttgggcctgctgtagcgtccctgatcagcagtgggccgaga
acctcctctcctgccacagcaaaggatagggcggttaacgtcggtcccaaaggcccacct
tctttccctgggacgcccgtcatgacctctccagtgctgggacctccacctccaccacct
gttaactatggtccaccaccagctccctttcctggacactacgggcctgggcctcgacct
ctccctgtgcccctagtttgtggtgctcccttaccaccaccagctgcaagagatttcttg
cctggcccatccttaggaataagagatctgcctcctgggccactgccacccctcccagac
cccagaagctacagacgtgggcaccctcatttccggcctccaggtcctcctggcccacgt
gattatccgccaggcccgccgctaccaccgcctgcctccagggactacgcaccttctcgg
agcagagacttgcctccagcaggacccagagactaccccgcaggccccgcaccgcccccg
gcaggctcaaaagactacgcacagcctccagtgcagaagccctaa

DBGET integrated database retrieval system