KEGG   Gallus gallus (chicken): 421346Help
Entry
421346            CDS       T01006                                 

Gene name
IARS2
Definition
(RefSeq) isoleucine--tRNA ligase, mitochondrial precursor
  KO
K01870  isoleucyl-tRNA synthetase [EC:6.1.1.5]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    421346 (IARS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gga01007]
    421346 (IARS2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gga03016]
    421346 (IARS2)
Enzymes [BR:gga01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.5  isoleucine---tRNA ligase
     421346 (IARS2)
Amino acid related enzymes [BR:gga01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   421346 (IARS2)
Transfer RNA biogenesis [BR:gga03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    421346 (IARS2)
 Prokaryotic type
   Other AARSs
    421346 (IARS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g tRNA-synt_1_2 tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 421346
NCBI-ProteinID: NP_001006397
CGNC: 7282
Ensembl: ENSGALG00000009566
UniProt: Q5ZKA2
Position
3
AA seq 1000 aa AA seqDB search
MLGAWRAAPRLRLRARFGVASVWARSAASEANSRRPAEESRQDSQYRDTVLLPHSRFAAQ
LPGRLQPDTELETQQKSGFLELYSWQRQRKAKQEFCLHDGPPYANGDPHVGHALNKILKD
ITNRFHMMRGYKVHYVPGWDCHGLPIELKALSEVKGAENLSPVEIRQKAKEFAERAIEKQ
KAAFIRWGIMADWANCYRTFDPKYEANQLRVFHKMYDKGFIYQDYKPVFWSPSAKTALAE
AELEYNEQHVSRSVYMKFPLLKSPPKLASVIDGSSPASVLVWTTQPWTVPANQAVCYMPD
AEYSVVKCATTGEHLILAADRVESTAAVLDTQFEVISTCKGVDLADGSCAHPTIAGRVSP
LLPANHVTMTKGTGLVHTAPAHGMEDYNVASHHQLPTECLVDESGHFTEAAGPELKNKNV
LEEGNEAVIKMLQAAGSLLKEEKYVHSYPYDWRTKKPMIIRASKQWFVNTANVKATAQEA
LKKVKIIPTSAVNRMLEMLDRRTFWCISRQRCWGVPIPVFYQKDTGESLINSETIADVIK
IVEQQGTDAWWTLPIEQLLSKEAVAKAGGHNVLDYVKGQDVLDIWFDSGTSWAHVLEGAE
QRADVYLEGKDQLGGWFQSSLLTSVATRKKAPYKTLVVHGFTLGEKGEKMSKSIGNVVDP
DVVINGGDDHTKDPPYGADVLRWWVAESNVFTEVLIGPVVLNAARDDINKLRNTLRFMLG
NMAGFNPETDSIPPSEMYIVDQYMLHLLQDYGSKVTEAYKEYDYSKVVRLLQAFCSRNLS
NFYFSIIKDRLYCEEEKDPKRRSCQTVLAEALDVVVRSFAPILPHLAEEVFQHLPYKKDS
EGVFRTGWINASSGWKKPGIEEAIEGACAMRDSFLGSISGKNALEYEVIIVIEPGLLFEL
MEALQAEESSRVSQLNEIMMASQTTLLSEIPKETPADANIVKGNFLINLEGGDIREESSY
QVIALPTTKAKCPRCRRYTSDSSSTPCPRCLKVIAGKGST
NT seq 3003 nt NT seq  +upstreamnt  +downstreamnt
atgttgggggcatggcgggccgcgccgcggctacggctccgcgcccgcttcggggttgcc
tccgtctgggcgcgctcggccgcttcggaggccaacagccggcggcccgcggaggaaagc
cggcaggactcgcagtaccgggacacggttctgctgccgcacagccgctttgccgcccag
ctgccgggccggctgcagcccgacaccgagctggagacgcagcagaaaagtggtttcttg
gagctgtactcgtggcaaaggcaaaggaaagccaagcaggagttctgtcttcatgatgga
ccaccgtatgctaatggagaccctcacgttggccatgctttaaataaaattttgaaagac
atcactaatcgtttccacatgatgagaggctataaagtgcattatgtgccaggatgggat
tgtcatggattgccaattgaattgaaggcattgtcagaagtcaaaggagccgaaaatctg
tcaccagtggaaattagacaaaaagccaaggaatttgcagaaagagccattgagaagcag
aaagctgccttcattcgttggggcatcatggcagattgggccaactgctatcgtacgttt
gatccaaagtatgaagctaaccagctgagagtcttccacaaaatgtatgataagggtttc
atttatcaggactataaacctgtgttttggtctccttcagcaaagacagccttggctgaa
gcagagcttgaatacaacgagcagcatgtcagtcgttctgtgtacatgaaatttcccctg
ctgaagtcgccgcctaagctggcctctgtgatagatggatcatcccctgccagtgtgctg
gtctggaccacgcagccttggactgtgcccgcgaatcaagcagtttgctacatgccggat
gcagaatattcggttgtgaagtgtgcaactactggtgagcacttaattctagctgcagat
agagttgaatccacagcggctgttttggacacacagtttgaggttatatcaacgtgtaaa
ggtgtagatttagctgatggttcttgtgctcatcccacaattgctggcagagtatctcct
ttgttacctgcaaatcatgtgacaatgacaaaaggaacaggattagttcacacagcccca
gctcatggtatggaagactacaacgtagcttctcaccatcagctacccacggaatgcctt
gtggatgaaagtgggcattttactgaagctgcaggtcctgaacttaaaaacaagaatgta
cttgaagagggaaatgaagctgtcattaagatgcttcaagcagcaggaagtttgttaaaa
gaggagaaatatgtacacagctacccatatgactggaggactaaaaaaccgatgattatt
cgtgccagcaagcagtggtttgttaacacagcaaatgtaaaggctacagcacaggaagcg
ctaaaaaaagtgaaaattattcctacatctgcagtgaacagaatgcttgaaatgctggac
agaaggacgttttggtgtatatcacggcagagatgttggggtgttcctattcctgttttt
tatcagaaggacacaggagaaagcctgataaacagtgaaacaatcgcagatgtcatcaaa
atagtggagcagcaaggaacggatgcgtggtggacccttcctattgagcagctgttatca
aaagaggctgtagcaaaggctggtggtcacaatgttttggattacgtcaagggacaggat
gtcctagacatctggttcgatagtggaacttcctgggctcatgttttggaaggtgcagag
caaagagcagatgtatacctcgagggaaaggaccaactgggaggctggtttcaatcttct
ctattaacaagtgtggcaacaaggaaaaaagcaccatataagactctggtagttcatggg
tttactctcggtgagaaaggggaaaagatgtccaaatccatcggcaatgtggtcgaccct
gatgtggtaatcaatggaggtgacgatcacaccaaggaccccccgtacggtgccgatgtt
ctccgctggtgggtggctgaatccaatgtttttactgaggtgctgatcgggcctgtggta
cttaacgctgccagagacgacatcaacaagcttcggaatacactacgtttcatgctggga
aatatggctggcttcaatccagaaacggattccatccctccttcagagatgtacatagta
gaccaatacatgctgcatttactgcaagactacggcagcaaggttacagaggcatacaaa
gaatacgattacagcaaagttgttcgattgctgcaagcattctgttccagaaacttgtct
aacttttatttcagcataatcaaagacaggctctactgtgaagaagaaaaagatcctaag
cgtcgttcgtgccaaactgtgctagcagaggcattagatgtagtagttcgatccttcgca
ccaatccttcctcacttagcagaggaggttttccagcacctcccctacaagaaagactca
gagggtgtgtttcgtactggctggattaatgcaagctcagggtggaagaaacctgggatt
gaggaagcaatagaaggtgcatgtgcaatgagagactctttccttgggtccatctctggc
aagaatgctttggaatatgaagtcatcattgtaattgagcctggattgctatttgaatta
atggaggcactacaggctgaagagtcttcgagagtgtcacagctgaatgaaataatgatg
gcttctcaaacaactctgttgagtgagatacctaaagaaacacctgcagatgcaaacatc
gtcaaaggaaactttttgattaacttagaaggtggagatattcgtgaagaatcttcatat
caagtcatagccctacccactaccaaagcaaaatgccctcgctgcaggaggtacacttcg
gattcctcaagcactccttgcccccgctgcctcaaagtcattgctggaaaaggaagcaca
tga

DBGET integrated database retrieval system