KEGG   Gallus gallus (chicken): 421348Help
Entry
421348            CDS       T01006                                 

Gene name
EPRS
Definition
(RefSeq) bifunctional glutamate/proline--tRNA ligase
  KO
K14163  bifunctional glutamyl/prolyl-tRNA synthetase [EC:6.1.1.17 6.1.1.15]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00860  Porphyrin and chlorophyll metabolism
gga00970  Aminoacyl-tRNA biosynthesis
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    421348 (EPRS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    421348 (EPRS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gga01007]
    421348 (EPRS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gga03016]
    421348 (EPRS)
Enzymes [BR:gga01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.15  proline---tRNA ligase
     421348 (EPRS)
    6.1.1.17  glutamate---tRNA ligase
     421348 (EPRS)
Amino acid related enzymes [BR:gga01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   421348 (EPRS)
Transfer RNA biogenesis [BR:gga03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    421348 (EPRS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1c WHEP-TRS tRNA-synt_1c_C ProRS-C_1 HGTP_anticodon tRNA-synt_2b GST_C_3 GST_C GST_C_2 tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 421348
NCBI-ProteinID: NP_001006398
CGNC: 7307
Ensembl: ENSGALG00000009598
UniProt: Q5ZJ86
Position
3
AA seq 1601 aa AA seqDB search
MAALSLTVQADSPPLGALLTVELVKNDVKISVEEGKETILRVSEHVSFTNVNSIVRYLAR
VAASAGLYGANLLEHTEIDHWLEFSATKLSTASQFLSAVQELNHCLSLRTYLVGNSLSLA
DVCVWAVLKDNNIWQEQLQQNKAPIHAKRWYGFLDVQQAFQSVGAKWASGTPKVKMATEK
KADVGKFVELPGAEMGKVIVRFPPEASGYLHIGHAKAALLNQHYQVNFKGKLIMRFDDTN
PEKEKEDFEKVILEDVAMLHIKPDQFTYTSDHFETIMKYAEQLIQEGKAYVDDTPAEQMK
AEREQRMESKHRNNCVNKNLQMWEEMKKGTEYGQTCCLRAKIDMNSNNGCMRDPTLYRCK
NQPHPRTGTTYKVYPTYDFACPIVDSIEGVTHALRTTEYHDRDEQFYWIIEALGIRKPYI
WEYSRLNLNNTVLSKRKLMWFVNEGLVDGWDDPRFPTVRGVLRRGMTVEGLKQFIAAQGS
SRSVVNMEWDKIWSFNKKVIDPVAPRYTALLKDAVVPVNVPEAQEEMKEVAKHPKNADVG
LKPVWYGSKVLIEGADAETLTEGEVVTFINWGNIIITKLNRNSSGKIVSIDTKLNLDNKD
FKKTTKITWLAETPRAPLIPTVCVNYEHLITKPVLGKDEDFKQYINRNSKQEELMLGDPC
LKDLKKGDIIQLQRRGFFICDQPYEPVSPYSCKEAPCILIYIPDGHTKEMPTSGSKEKTK
AETAKKEASSAVKGKSVPLADDTSTATCTASEDHLVMYNRVAAQGDIVRDLKAKKAAKED
IDKAVKQLLALKAEYKEKTGQEYKPGNPPAAVTKQHASSTHENSATLDCKALYDKVAEQG
EVVRKLKAEKAPKEQVDEAVKVLLNLKAEYKQKTGQEYKPGNPPSAPPCASSATLPSSVC
CNNLGPSSLVDAKALYDNVAEQGEVVRRLKAEKASKGEIDEAVKLLLSLKADYKEKTGQD
YKPGHPPVAQDSLPQASNTIPSGPDTTEAKALFNKVALQGDEVRKLKAEKAEKEKIDAAV
KELLQLKAQYKSVAGVDYKPASASSADDKDKKKKEKENKSEKQCKQQKQNDGPKKEPLQG
QSGNELSSNGPGEGQGPKKQTRLGLEAKKEENLADWFSQVITKAEMIEYYDVSGCYVLRP
WAYAIWEAIKNFFDAEIKKLGVENCYFPMFVSQAALEKEKSHIADFAPEVAWVTRSGKTE
LAEPIAIRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQE
GHSAFATYEEAAEEVMQILDLYAQVYEDLLAIPVVKGRKTEKEKFAGGDYTTTVEAFISA
SGRAIQGATSHHLGQNFSKMFEVMFEDPKKPGEKQYAYQNSWGITTRTIGVMTMIHGDNV
GLVLPPRVACVQVVIIPCGITNTLSEEDKEALLKKCNEYRKRLLSANVRVRADLRDNYSP
GWKFNHWELKGVPIRLEVGPRDMKSQQFVAVRRDTGQKLTFSEHEAEDKLKQVLEEIHAN
LYNRASEDLRSHMVVANTMEDFQKELDSGKIVQIPFCGESECEDWIKKTTARDQDLEPGA
PSMGAKSLCIPFQPLRELQSGAKCVCGKNPAKFYTLFGRSY
NT seq 4806 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctgagcctcacggtgcaggcggacagccccccgctcggagctctgctgaca
gtggagcttgtgaagaatgatgtcaaaatttcagtggaagaaggcaaggaaaccatcctt
cgtgtatctgagcatgtttcatttaccaatgtgaattcaatagttcgctacctggctaga
gttgctgcttctgctgggttgtatggtgcaaaccttttggaacacactgagatcgaccac
tggctagagtttagtgctacaaagttatctactgccagccagtttctttcagcagtccaa
gagctcaaccactgcctatctctgagaacctacttggttggaaactctctgagtcttgca
gatgtctgtgtctgggctgtcctaaaagataataacatctggcaagagcaattacagcaa
aataaagctcccatccatgcaaaacgatggtatggctttcttgatgtccaacaagctttt
cagtctgtaggagccaagtgggcttctggcactccaaaggtcaaaatggcaactgaaaag
aaagcagatgttgggaagtttgttgaacttcccggtgcagagatgggaaaggtcattgta
cgatttcctcctgaagcaagtggatatctgcatatcggtcatgccaaagctgctctgcta
aatcaacactaccaggttaacttcaaaggcaaacttattatgaggtttgatgacacaaat
cctgaaaaagagaaagaagactttgaaaaggttattcttgaagatgtcgcaatgctgcac
atcaaaccagaccaatttacatatacctcagatcactttgaaacaataatgaaatacgct
gagcagcttattcaagaagggaaggcatatgtggatgatactcctgcagaacaaatgaaa
gcagagcgtgagcaaagaatggaatctaaacacagaaataactgtgttaacaagaatcta
caaatgtgggaagaaatgaaaaagggaacagagtatggacaaacttgttgtctacgagca
aaaatagatatgaatagtaacaatggatgtatgagggatccgactctttatcgttgtaaa
aaccagcctcacccacgtacaggaactacctacaaggtttatcctacatatgactttgcc
tgccccatcgttgacagtattgaaggtgtcacacatgctcttagaacaacggaataccat
gacagggatgaacagttctactggatcattgaggcattgggcataaggaagccgtacata
tgggaatacagcaggctaaacctcaacaacactgtgctgtccaaaagaaagcttatgtgg
tttgtcaatgaagggcttgtggatggatgggatgacccaaggtttcccactgtgcgtggg
gtcctgagaagaggcatgacggttgaagggctaaaacagttcattgctgctcagggctcc
tctcgatctgttgtgaatatggagtgggataaaatttggtccttcaacaaaaaggttata
gatccagtagcacctcggtacactgctttactgaaagatgcagtggtcccagtcaatgtt
cctgaagctcaagaggagatgaaggaagtggctaaacatccaaagaatgccgatgttggg
ttgaaacctgtgtggtatggctccaaagtgctgatagagggtgcagatgcagagaccctg
acagagggagaggtggttacgttcataaattggggcaatattatcatcactaaattaaac
agaaattcaagtggaaaaattgtgtccattgataccaagttgaacttagataataaagac
ttcaaaaaaaccactaagatcacttggttagcagagactccacgtgcaccactcatccca
accgtttgtgttaattatgaacatctgatcactaaaccagttctaggtaaagatgaagat
ttcaagcaatatatcaaccgaaatagcaagcaagaagaactgatgttaggtgatccttgt
cttaaggatttaaagaaaggggacattatccaacttcagaggagaggattctttatttgt
gatcaaccctatgagccagtgagtccatatagctgtaaagaggccccatgcattttgatt
tacatccctgatggacacactaaggaaatgccaacatctgggtcaaaagagaagaccaaa
gctgaaactgcaaagaaagaggctagttcagctgtaaaaggaaaatctgttccacttgct
gatgatacctctactgcaacctgtactgcctcagaagaccacctggttatgtacaacagg
gtggctgcacagggtgatattgttcgtgatttgaaagctaagaaggcagcaaaggaagat
attgataaagctgtgaagcagttgctggccttgaaagcagaatacaaagagaagacgggc
caggagtataagcctggaaatcctccagcagctgtaactaaacagcatgcgtcttcaaca
catgagaactctgctaccctggactgcaaagctctgtatgataaagtagcagagcaagga
gaagtggtccgaaaactgaaagctgagaaagcacctaaggaacaagtagatgaagctgtg
aaggttctcttaaatctgaaagcagaatataaacaaaagacaggtcaagagtataagcct
ggaaatccaccttcagctcctccttgtgcgtcttctgctacacttccatcttctgtatgc
tgcaataacttgggaccttctagcttagtggatgccaaagcactttatgataatgtagct
gaacaaggggaagtggtgcgacgactcaaggcagagaaagcttccaagggtgaaatagat
gaagcagtaaaactcctcctttctctaaaagctgactataaggaaaagactggacaggac
tacaagcccggccatccgccagtagctcaggattctttgccccaggcatcaaatacaata
ccaagtggtcctgacacaactgaagctaaagcactgtttaacaaagtagctcttcaagga
gatgaagttaggaaattgaaagcagaaaaagcagaaaaggaaaagatagatgcagctgtt
aaagagcttcttcagctaaaggctcaatacaagtctgttgcaggagttgattataaacct
gcttctgctagtagtgctgatgacaaagacaaaaagaagaaagagaaagagaacaagtca
gaaaagcagtgtaagcaacagaaacaaaatgatggaccaaaaaaagagcctttgcaagga
cagagtggtaatgagctctcttcaaatgggccaggagagggtcaaggccctaagaaacaa
accaggttgggtttggaagccaaaaaagaagaaaatcttgcagactggttctctcaggtg
atcacaaaagcagagatgattgaatactatgatgtgagtggctgttatgttcttcgtcct
tgggcttatgccatttgggaagctatcaagaacttctttgatgctgagatcaagaaactt
ggtgtggaaaactgctacttccccatgttcgtgtcccaagctgctctagagaaagagaag
agtcatattgctgattttgcccctgaggttgcttgggtcacaagatctgggaaaacagaa
ctcgctgaaccaattgctatacgtcccacaagtgaaacagttatgtatcctgcatatgca
aagtgggtgcagtcccacagagatcttcctatcaagcttaatcagtggtgcaatgttgtg
cgttgggagttcaaacatcctcagcctttccttcgcactcgtgagttcctttggcaggag
ggtcactcggcatttgcaacatatgaagaagctgcagaggaagtcatgcagatacttgat
ctttatgctcaagtgtacgaagatctcctagcaatacctgttgtgaaaggaagaaagaca
gaaaaggagaaatttgctgggggtgactatacaacaactgtagaggcatttatatctgcc
agtggaagagctatccagggtgcaacatcacatcacctagggcagaatttctcaaagatg
tttgaagtcatgtttgaagatcccaagaaaccaggagaaaaacagtacgcgtatcagaat
tcctggggcattacaactcgaactattggtgtaatgacaatgattcatggagataacgtg
gggttggtgctcccgcctcgagtagcttgtgttcaggttgtaattattccctgtggtatc
acaaataccctttctgaagaggacaaagaggctttattgaagaaatgtaatgagtatcgt
aaaaggctgcttagtgctaatgtccgtgtacgtgctgatttaagagacaactattcacct
ggctggaagttcaatcattgggaacttaagggtgtacctatcaggcttgaagtgggaccg
cgagacatgaagagccaacagtttgtagctgtcagaagagacacgggacagaagctgacc
ttttcagaacatgaggcagaagataaactgaagcaggttttggaggaaatccatgctaat
ctatacaacagagcttctgaagacttaagaagtcatatggtggtggccaatactatggaa
gactttcaaaaagagcttgattcaggaaagattgtacaaatccctttttgtggggaaagt
gagtgcgaggattggatcaagaagaccactgccagagatcaagatctggagcctggtgcc
ccctccatgggagcaaaaagtctttgcatacctttccagcctctccgtgaactacagagt
ggggcaaaatgtgtctgcggcaagaaccctgccaagttctacaccctctttggtcgtagt
tactaa

DBGET integrated database retrieval system