KEGG   Gallus gallus (chicken): 421352Help
Entry
421352            CDS       T01006                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta-2 precursor
  KO
K13376  transforming growth factor beta-2
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04060  Cytokine-cytokine receptor interaction
gga04068  FoxO signaling pathway
gga04110  Cell cycle
gga04218  Cellular senescence
gga04350  TGF-beta signaling pathway
gga04933  AGE-RAGE signaling pathway in diabetic complications
Module
gga_M00680  TGF-beta signaling
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    421352 (TGFB2)
   04350 TGF-beta signaling pathway
    421352 (TGFB2)
   04068 FoxO signaling pathway
    421352 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    421352 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    421352 (TGFB2)
   04218 Cellular senescence
    421352 (TGFB2)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    421352 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:gga04052]
    421352 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:gga00536]
    421352 (TGFB2)
Cytokines and growth factors [BR:gga04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   421352 (TGFB2)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate/Haparin
  Growth factors/receptors
   421352 (TGFB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Motif
Other DBs
NCBI-GeneID: 421352
NCBI-ProteinID: NP_001026216
CGNC: 51471
Ensembl: ENSGALG00000009612
UniProt: F1NNP2
Position
3
AA seq 412 aa AA seqDB search
MHCYLLSVFLTLDLAAVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPDEYPEP
EEVPPEVISIYNSTRDLLQEKANHRAATCERERSDEEYYAKEVYKIDMQPFYPENAIPPS
YYSLYFRIVRFDVSAMEKNASNLVKAEFRVFRLQNSKARVSEQRIELYQVLKSKELSSPG
QRYIDSKVVKTRAEGEWLSFDVTEAVHEWLHHRDRNLGFKISLHCPCCTFVPSNNYIIPN
KSEELEARFAGIDDYTYSSGDVKALKSNRKKYSGKTPHLLLMLLPSYRLESQQPSRRKKR
ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYHANFCAGACPYLWSSDTQHSR
VLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgcactgctatctcctgagcgtgttcctcaccctggatctggccgccgtggctctcagc
ctgtctacctgcagcaccctcgacatggatcagttcatgcgcaagaggatcgaggcgatc
cgggggcagatcctgagcaagctgaagctcaccagccccccggacgagtaccccgagccc
gaggaggtgcccccggaggtcatctccatctacaacagcaccagggacctgctgcaggag
aaagccaaccacagagctgccacttgcgagagggagcggagcgacgaggagtactacgcc
aaagaagtttacaaaatagacatgcagcctttttaccccgaaaatgccatcccaccaagc
tattacagcctttacttcagaattgttagatttgacgtctcggcgatggagaaaaatgcg
tccaacttggtgaaggctgagttcagggtcttccgcctgcagaactcaaaggcgcgggtc
tcggagcagcggatagagctgtaccaggttctgaaatccaaagaattatcatcaccagga
cagcgttacattgacagcaaagtggttaaaacaagagctgaaggagaatggttgtctttt
gatgtcactgaggctgtacatgaatggctccatcacagagacaggaaccttggatttaag
ataagcttacattgtccatgctgcacctttgtgccttccaataattatatcatcccaaat
aaaagtgaggagcttgaagcaagatttgcaggtattgatgactacacatattccagtggt
gatgtgaaagctttaaagtccaataggaaaaaatacagtgggaagaccccacatcttctg
ctaatgttgttaccctcctacagacttgagtcgcaacagcccagtcggcggaagaagcgt
gctctagatgctgcctattgttttaggaatgtgcaggataattgctgcctgcgtccactt
tatattgacttcaagagggatcttggctggaaatggattcatgaacctaaaggatatcat
gccaatttctgtgcaggagcctgcccatatttatggagctcagatactcagcacagcaga
gtactcagcttgtataacaccataaatccagaagcttctgcctctccgtgctgcgtgtcc
caggatttagagcccctcaccatcctctactacattggcaaaacacccaaaatcgaacag
ctgtccaacatgattgtaaagtcttgcaaatgcagctaa

DBGET integrated database retrieval system