KEGG   Gallus gallus (chicken): 421363Help
Entry
421363            CDS       T01006                                 

Gene name
ANGEL2
Definition
(RefSeq) protein angel homolog 2
  KO
K18729  protein angel
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:gga03019]
    421363 (ANGEL2)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     421363 (ANGEL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Exo_endo_phos Imm8
Motif
Other DBs
NCBI-GeneID: 421363
NCBI-ProteinID: NP_001026218
CGNC: 7447
Ensembl: ENSGALG00000009802
UniProt: Q5ZM21
Position
3
AA seq 558 aa AA seqDB search
MLPRHVQRLGRDWITHVNGSQVFAFSSPVPTCMRWAGHCPWAPFPLPVPVDFSANWRLPL
FFGPWRQFQNSNWQLDNFAQNSCIHLPNPSMKAEGEEPVTKKRRLSAQPDSPAPEEVNFS
EQKEALCVSVSQDEKSESNKKVNIKRHWEYFCQHSRTMKILESTETDQSNRECEARFDFT
VMSYNILSQNLLEDNSHLYKHCRQRLLIWTYRFPNILQEIKQLDADVLCLQEVQEDHYRK
EIKSSLESLGYHCEYKMRTGRKSDGCAICFKTSKFSLISSNPVEFFRRDIPLLDRDNVGL
VLLLQPKFPCKTNAAICIANTHLLYNPRRGDIKLTQLAMLLAEIASVAPQKNGSFCPIVM
CGDFNSVPGSPLYRFIKEGKLNYEGLAIGKVSGQEQFPRGQRILSIPIWPKKLGISQNCV
YEIKQQQKEDDAGEKTEGATSDNTKEIVIASEKLSSKLQHHFKLSSVYSHYFPETGLPEV
TTCHSRSAVTVDYIFYSAANDDSVAQPGMEDSLHGGLKLLGRLALLTEKDLWTVNGLPNE
NNPSDHLPLLAEFRLIER
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgctgccccgccatgtgcagaggctgggccgagactggatcacccacgtcaacggttct
caggtatttgccttcagcagcccagtccccacctgtatgagatgggctggacactgccca
tgggcccccttccctctgcctgttccagttgatttctcagcaaactggaggctcccactg
ttttttggaccttggaggcaatttcagaactctaattggcagctcgataactttgcacaa
aattcttgcattcacctacctaaccccagtatgaaagctgagggagaagaaccagtgaca
aagaagaggagactcagtgcccagccagattctccagcccctgaagaagtgaacttctct
gagcagaaagaagcattatgtgtttctgtctcacaggatgaaaaaagtgagagtaacaag
aaagtaaatatcaaaagacactgggaatatttctgtcagcacagcaggacaatgaaaatc
ttggaaagtacagagactgaccaaagcaatagagaatgtgaagccagatttgatttcaca
gtcatgtcctacaacatcctctcacagaatttgttagaagataactcccacctgtacaaa
cactgcagacaacgtttgttaatctggacatacagatttcccaacattctacaagaaatc
aagcagctggatgcagatgtactttgtctacaagaagtccaagaagaccactataggaaa
gagatcaagtcaagtttggaatccttggggtatcactgtgagtataaaatgaggacaggg
agaaaatctgatggctgtgctatttgcttcaaaacttctaaattcagcctgatctcatca
aatcccgtcgagttttttcgccgtgatattccactcttggacagggacaacgttggacta
gtgttgcttctgcagcctaaatttccatgtaaaacgaatgctgccatctgtatagctaat
acgcatctgctgtataacccgaggagaggggatatcaaactgacccaactggcaatgctc
ctggcagagattgcgagtgttgcccctcagaagaatggttccttctgcccaattgtcatg
tgtggtgacttcaattctgttcctgggtctccgttgtacagatttataaaggaagggaag
ttaaattatgaaggacttgctatagggaaggtctctggacaagaacagtttccaagggga
caaagaatcttatctattccaatttggcccaaaaaattaggtatttcacaaaactgtgtg
tatgaaataaaacagcagcaaaaagaagatgatgcaggagaaaaaacggagggagcaacg
tcggataataccaaagagattgtaatagcatctgaaaaattgtcctcaaaactgcagcac
cattttaagttgtcttcagtctattctcactactttcctgagactgggttgccagaagta
acaacttgtcactcccgaagcgcagtcactgtggattatattttctattctgcagcaaat
gatgattctgttgcccagccagggatggaggattctcttcatggaggtctgaagctcctc
ggtaggctggcacttctaacagagaaagatctctggactgttaatggtcttcccaatgaa
aataacccctctgaccacctgccattgctcgcagagttcaggctcattgaacggtaa

DBGET integrated database retrieval system