KEGG   Gallus gallus (chicken): 421369
Entry
421369            CDS       T01006                                 

Gene name
ATF3
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-3
  KO
K09032  activating transcription factor 3
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    421369 (ATF3)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    421369 (ATF3)
   AP-1(-like) components, CRE-BP/ATF
    421369 (ATF3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf SNAPc19 Ribosomal_L6e GAGA_bind RR_TM4-6 DivIC
Other DBs
NCBI-GeneID: 421369
NCBI-ProteinID: XP_015139360
CGNC: 66403
Ensembl: ENSGALG00000025887
UniProt: A0A3Q3B2P0
Position
3
AA seq 181 aa
MMVQHTGQVSALEVSASAIVPTLSPAGSLGFDDFTNLTPLVKEELRFAIQNKRQSHRMSS
TLDTVTVSERPMETSIMKTEFSPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEK
LETINAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQ
G
NT seq 546 nt   +upstreamnt  +downstreamnt
atgatggtccaacacaccggccaggtgtctgcattggaagtcagcgcctccgcaattgtc
cccactttgtcccctgcagggtcactggggtttgatgatttcacaaatctaaccccactg
gtgaaagaggaacttagattcgccatccaaaacaaacgtcagtcccacaggatgtcttct
actttggatacggtgacagtgtccgaaaggccgatggaaacatcgatcatgaaaacggag
ttttctcctgaagaggatgaaagaaaaaagcgaagaagggaaaggaacaaaattgctgct
gcaaagtgccgaaacaaaaagaaggaaaaaacagaatgtttgcagaaagaatcagaaaag
ctggagactatcaatgcggaattaaaagcccagattgaagagctaaagaatgagaagcag
catttgatatacatgctaaatcttcacaggcccacctgtatagtccgggcacaaaatgga
aggacacctgaagatgaaaggaatctttttattcaacagatcaaagaaggaacattacaa
ggttaa

DBGET integrated database retrieval system