KEGG   Gallus gallus (chicken): 421384
Entry
421384            CDS       T01006                                 

Gene name
DIEXF
Definition
(RefSeq) digestive organ expansion factor homolog
  KO
K14774  U3 small nucleolar RNA-associated protein 25
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:gga03009]
    421384 (DIEXF)
Ribosome biogenesis [BR:gga03009]
 Eukaryotic type
  90S particles
   U3 small nucleolar RNA-associated proteins
    421384 (DIEXF)
SSDB
Motif
Pfam: UTP25 DEAD
Other DBs
NCBI-GeneID: 421384
NCBI-ProteinID: NP_001026222
CGNC: 7511
Ensembl: ENSGALG00000009887
UniProt: Q5ZLG3
Position
3
AA seq 772 aa
MGKRRGGRELARGLSKRQRKHLRQFGEQHPVCDRVSGRPEATQICELSDNSDKSSAESDS
ETEVEQVSVYHKLLATLKASPESESEEEEDESESEEAGESEAELDSEGSQEPKEAVGGEE
EQNDVPEQEEEVAAKDPPEQAFGQEEADGVETSCDPNRGAIEEFTDVKHEAEFSLETNFM
EEESGDCDADKRESNSSQAFSEDPFKQHMDKELEEKEVEKISTLSKTSSQSKWPRLGQLT
FSSTLEKHTTLKPDKEFSVKQLYLHKPLESTWPKVNKHYLSSASKPSDSFFTPLQRELFC
IMNTYRDLFYPERNALTNGEEIRHAYCLHALNHILKANAQVLSNNAKKRDQKPGTDSDDY
RDQGLTRPKVLMIVPFRECALRIVHIFISLLEVNEKRKIDVSNKKRFKGEFGSDPDEKPP
NLKRPEDYEAVFAGNIDDHFRIGVAILQKSMRLYAPFYSSDIIIASPLGMRTIIGTEGEK
KRDFDFLSSIEMLIIDQADIYLMQNWEHVLHLMRHINLLPLDSHGVDFSRVRMPNLNNWS
KYYRQTLLFSALQDPQINAIFNKHCFNYVGQVAVRNVPLSGSISRVVVQLPHVFRRIEAE
NLTSVIDTRFQFFIDKVLPEYRDAIMSHTLIYVPSYFDYVRLRNYFKKEELNFTHICEYT
KKAGICRARRSFLKGEKQFLLLTERFHFYKRYTIKGIRNLIFYELPTYSHFYSEICNMMK
ATDSGVDATWTCTVLYSKYDAQKLAAVVGIDRTAQMLQSKKNVHLFVTGENE
NT seq 2319 nt   +upstreamnt  +downstreamnt
atggggaagcggcgcggcgggagggagctggcgcgtggcctcagcaagcggcagaggaaa
cacctgcggcagttcggggagcagcaccccgtctgcgaccgggtttctggaagaccagaa
gcaactcaaatatgtgaactgtctgataattctgataaatcaagtgcggaaagcgattca
gagactgaggtggaacaggtctctgtctatcacaagcttctggctaccctgaaggcatct
cctgagtctgagagtgaggaggaggaagatgaaagtgaatcagaagaagctggggagagt
gaggcagaactggacagcgaagggtcccaagagcccaaagaagctgttggaggtgaagaa
gagcagaatgacgtaccagagcaggaagaagaagtcgcagctaaagacccaccagaacag
gcatttggccaggaggaggctgatggggtggaaacttcctgtgacccgaatcgtggggca
attgaggagtttactgatgtgaaacatgaagctgaatttagcttggaaaccaatttcatg
gaagaggagagtggagactgcgatgcagacaagagagagagcaattcttcacaagccttt
tcagaagatccctttaaacagcacatggacaaagaactcgaagaaaaagaagtagaaaaa
atatcaacgctttctaaaacttcaagtcaaagcaagtggccaaggctgggtcagctcact
ttttcatccactttggagaagcatacaactttaaaaccagacaaagaattcagtgtgaaa
cagctttatctacacaagcctttagaatccacttggcctaaagtgaataaacattacctg
tcctcagcaagcaaaccaagcgattcctttttcaccccgttacaaagagagctcttctgt
atcatgaatacctacagggacttgttctatccggagagaaatgctttaacaaatggagaa
gaaatccggcatgcttactgcttacatgccttgaaccacattctgaaggcaaacgcccag
gtgctcagcaacaatgccaaaaaacgagaccaaaagccagggactgacagtgacgactac
agggatcaggggctcaccagacctaaggtgctgatgatagtgcccttccgggaatgtgct
ttgcgaattgtgcatattttcatcagtcttcttgaagtgaacgagaaaagaaaaatagat
gtaagtaataagaagcgcttcaaaggggagtttggctctgacccagacgagaagcccccc
aacctgaaaagacctgaagattatgaagctgtcttcgctggcaacattgatgaccatttc
agaattggggttgcgattcttcaaaagagcatgagattgtatgcgccattttattcgtca
gacatcatcattgcctctcccctgggtatgaggactatcattggcacagagggagagaag
aagagagactttgattttctgtcatccatagaaatgctcataattgatcaggcagacatt
tacctaatgcagaactgggagcacgttctgcacctgatgaggcacattaacctgctgcct
ttggattcccatggagtagacttttcccgagtgcgaatgccgaacctcaataactggtcc
aagtactaccgccagacgctgctgttcagtgctcttcaagatccccagattaatgctatc
ttcaacaaacactgcttcaattacgtggggcaggtggctgtccgcaatgtgccgctgagc
ggctccattagccgtgttgtggtccagctccctcacgttttccggaggatagaagctgaa
aatttaacttctgtaatagatacaaggtttcagtttttcatcgacaaagttttgccggag
taccgcgatgccatcatgtcacacacgctcatttatgttccgtcgtattttgactatgtg
cgacttcgaaactacttcaagaaagaggagctgaattttactcacatctgtgagtacact
aaaaaggccggcatctgcagagcaaggcggtccttcctcaaaggagagaagcagttctta
ctgctcaccgagcgcttccacttctacaaaaggtacacaataaaaggcattaggaacctc
attttctatgagttaccaacctactcccacttctatagcgagatttgtaacatgatgaag
gccactgacagcggagtggacgctacttggacctgcactgtgctctactccaagtacgat
gctcagaaattggctgcagtggttggcatagatcgcaccgctcaaatgctgcagtccaag
aaaaatgtgcacctctttgttacgggagaaaatgaataa

DBGET integrated database retrieval system