KEGG   Gallus gallus (chicken): 421416Help
Entry
421416            CDS       T01006                                 

Gene name
FOSL2
Definition
(RefSeq) fos-related antigen 2
  KO
K09030  fos-like antigen 2
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    421416 (FOSL2)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    421416 (FOSL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ASD2 UPF0242 DUF5320
Motif
Other DBs
NCBI-GeneID: 421416
NCBI-ProteinID: NP_001039301
CGNC: 7631
Ensembl: ENSGALG00000010036
UniProt: P18625 F1NFV6
Position
3
AA seq 323 aa AA seqDB search
MYQDYPGSFDTSSRGSSGSPGHPEPYSAGAAQQKFRVDMPGSGSAFIPTINAITTSQDLQ
WMVQPTVITSMSSPYSRSHPYSHPLPPLSSVAGHTALQRPGVIKTIGTTVGRRRRDEQLS
PEEEEKRRIRRERNKLAAAKCRNRRRELTEKLQAETEVLEEEKSVLQKEIAELQKEKEKL
EFMLVAHSPVCKISPEERRSPPTSSLQSVRTGASGAVVVKQEPVEEEIPSSSLVLDKAQR
SVIKPISIAGGYYGEEALNTPIVVTSTPAITPGSSNLVFTYPNVLDQESPLSPSESCSKA
HRRSSSSGDQSSDSLNSPTLLAL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtaccaggactatcccgggagcttcgacacctcctccagaggcagcagcggctccccg
ggacaccccgagccctactccgccggcgcagcccagcagaaattccgagtagatatgcca
ggatcaggcagtgcttttattcccacgatcaacgccatcacaaccagccaagacctgcag
tggatggtgcagcccaccgtcatcacctccatgtccagcccgtactctcgctcgcacccc
tacagccacccactgccgccgctgtcctcggtggctggacacacggcccttcagcgaccg
ggcgtgatcaaaaccatcggcaccacagtgggacggagacgaagggatgagcagctgtcg
cctgaggaagaagagaagcgaaggatccggagagagaggaacaagctggcagctgctaaa
tgtcgtaacaggcgccgagagctaacagagaaactccaggcggaaactgaggtgctggag
gaggaaaagtcagtgcttcaaaaagagattgctgagctccagaaggagaaggagaaacta
gagttcatgctggttgctcacagccctgtgtgtaaaatcagccctgaggaacgtcggagc
ccaccaaccagcagcctccagagcgttcggactggagcgagcggagcagtggtggtgaag
caggagcctgtggaggaagagatcccatcttcctctttggtccttgacaaagctcagagg
tctgtcattaagcccatcagcattgctggaggttattatggggaggaggcactcaacact
cccatcgtggtgacctcgacaccagccatcactcctggttcctccaacttggtgttcacc
taccccaatgtcttggatcaggagtctcctctctccccgtccgagtcctgctccaaagct
caccggaggagcagcagcagcggcgaccagtcctcggattccttgaactctcccaccttg
ctggcattgtaa

DBGET integrated database retrieval system