KEGG   Gallus gallus (chicken): 421434Help
Entry
421434            CDS       T01006                                 

Gene name
CMTR1
Definition
(RefSeq) cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1
  KO
K14589  cap1 methyltransferase [EC:2.1.1.57]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:gga03019]
    421434 (CMTR1)
Enzymes [BR:gga01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.57  methyltransferase cap1
     421434 (CMTR1)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic Type
  mRNA processing factors
   5' end processing
    Capping factors
     421434 (CMTR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FtsJ G-patch WW mRNA_cap_enzyme DNA_ligase_A_M G-patch_2
Motif
Other DBs
NCBI-GeneID: 421434
NCBI-ProteinID: XP_015139279
CGNC: 7714
Ensembl: ENSGALG00000010149
Position
3
AA seq 831 aa AA seqDB search
MKRRTEPEFSSPQKKQKKKVEDLGLTLSSTSDDEAQLSNHTTQESSSSSSGSESESDEKR
LGFNNEFKQDSLVEGTSSRYSMYNSVSQKLMAKMGFREGEGLGKYGQGRKDIVEASNQKG
RRGFGLTLKGFDGELNIDWQDEPEPSAYEEVDWCLECTTEIPDAQELKEWMTVGKRKMVI
EDETEFCNEELLLNVLRCKSVFDELDGEEMRRARTRSNPYEMIRGVFFLNRAAMKMANMD
HVFDYMFTNPKDFQGRPLIKERDAELLYFADVCAGPGGFSEYVLWRKKWHAKGFGMTLKG
PNDFKLEDFYSASSELFEPYYGEGGIDGDGDITRPENITAFRNFVLDNTDHKGVHFLMAD
GGFSVEGQENLQEILSKQLMLCQFLMALSIVRTGGHFVCKTFDLFTPFSVGLVYLLYCCF
ERVCIFKPVTSRPANSERYVVCKGLKLGIDDVREYLFMVNIRLNQLRNSDVDVNLVVPLN
VIKDDQDFYDYIVQSNENHCKIQIKALAKIRAFVQDTTLIEPRQAEIRKECLQLWGIPDQ
ARVAPSSSDPKSKFFELIQGTDIDAFSYKPTPLNSSTLEKIRQVFDYRCMVSGSEQKFLL
GLGKSQIYTWDGRQSDRWTKLDLKTELPRDTLLSVEIVHELKGEGKAQRKISAIHILDVL
VLNGNDVRNQHFNQRIQLAEKFVKAVSKPSRPDMNPIRVKEVYRLEEMEKIFVRLEMKVI
KGSGGIPRLSYTGRDDRHFVPTGLYIVRTVNDPWTMAYSKNSKRKFFFNKMTNKSTFDLP
SESIAPFHVCHYSRLFWEWGDGVKVHDSQKRQDPEKLSKEGVLSFIQAHYP
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atgaagagaagaactgagcctgaatttagcagtccccaaaagaagcagaagaagaaggtg
gaagacttgggtttaactctcagttctacttcagacgatgaagctcagcttagtaaccat
actactcaagagtcttccagtagcagcagtgggtctgagagtgagagtgatgaaaaaaga
cttggcttcaacaatgagttcaaacaagactctcttgtggagggtacttcgtcccgctac
tcaatgtataacagtgtctcccaaaagctcatggccaagatgggcttccgggaaggagaa
ggtttgggaaaatatggccaaggtaggaaggatattgtcgaggcctccaatcagaaggga
aggagaggctttgggctaaccctcaaagggtttgatggggagctgaatattgattggcag
gatgagccagagcctagtgcctatgaggaggtggattggtgccttgagtgtaccacagaa
atccctgatgcccaggagctgaaggagtggatgactgtgggcaagaggaagatggtgatt
gaagatgaaacggagttctgcaatgaagagcttttacttaatgtcctgcggtgcaagagt
gtatttgatgagctggatggagaagaaatgcgcagagcccgaacaagatctaacccctat
gagatgatccgcggagttttttttctgaacagagctgcaatgaagatggcaaatatggac
catgtctttgactacatgtttacaaaccctaaggacttccaggggaggcccttgataaag
gagcgagatgcagaactgctctactttgctgatgtgtgtgctggtcctgggggcttctct
gagtacgtcttgtggaggaagaagtggcatgcaaaaggatttggcatgaccttgaaagga
ccaaacgattttaaacttgaggacttctattctgcttccagtgagctctttgaaccttac
tacggagaaggagggattgatggagatggagatatcactcgccctgagaacattactgcc
ttccggaactttgttttggacaataccgatcacaaaggagtgcatttcttaatggctgat
gggggcttctctgtggagggtcaggagaacttgcaagaaatcctaagcaaacagctgatg
ctctgtcagtttcttatggcactgtccattgtccggacaggaggacattttgtctgcaaa
acctttgacctgtttactccattcagcgtggggcttgtttatctgctgtattgctgcttt
gagcgtgtgtgcatctttaaacctgtgacaagccgccctgctaactcagagaggtacgtg
gtatgcaaaggattaaagcttgggattgatgatgtgcgagaatatctcttcatggtgaac
atcagactcaaccagttgcgcaactctgatgtggatgtgaatctagtcgtcccactgaat
gtgatcaaagatgaccaggatttctacgattatatcgtccagtccaatgaaaaccactgc
aaaattcagataaaggcactagctaaaattcgtgcttttgttcaagatacgacactgatt
gagccacgacaggctgaaatccgaaaggagtgtctccaactatgggggattcctgatcag
gctcgtgttgctccctcatcttcagatcccaagtccaagttctttgaactgattcagggc
acagacatcgatgccttcagttacaaacccactcctctgaattccagtacactggaaaag
atccgccaagtgttcgattaccggtgtatggtgtctggaagtgagcagaagttcctcctg
gggttagggaaatcacagatctacacctgggatggtcgccagtcagaccgctggacaaaa
ctggatttgaaaactgagctgccacgagatacccttttgtctgtggagattgttcatgag
ctgaaaggagaggggaaagcccaacgaaaaatcagtgctatccacatacttgatgtcttg
gtactcaatggcaatgacgtccgaaaccagcatttcaaccagaggattcagctggcagag
aagtttgtcaaagcagtttccaaacctagccgaccagatatgaacccgatccgagtgaag
gaagtgtacagactggaggagatggagaagatttttgtgaggttagagatgaaagtcatc
aaaggttcagggggaataccccgactgtcctacacaggaagagatgaccggcacttcgta
cccacgggactctacattgtacggactgtgaatgatccctggacgatggcatacagcaaa
aactccaagaggaaattcttcttcaacaagatgaccaacaaatcaacatttgacctccca
tctgaatccatcgcaccttttcatgtatgtcattacagccgcctcttctgggagtgggga
gatggtgtcaaagtgcatgactctcagaaaaggcaagatccagagaagctatcaaaggag
ggtgtcttatctttcatccaagcacactacccctag

DBGET integrated database retrieval system