KEGG   Gallus gallus (chicken): 421450
Entry
421450            CDS       T01006                                 

Gene name
XPO5
Definition
(RefSeq) exportin-5
  KO
K14289  exportin-5
Organism
gga  Gallus gallus (chicken)
Pathway
gga03013  RNA transport
Brite
KEGG Orthology (KO) [BR:gga00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    421450 (XPO5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gga03016]
    421450 (XPO5)
   03036 Chromosome and associated proteins [BR:gga03036]
    421450 (XPO5)
Transfer RNA biogenesis [BR:gga03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    421450 (XPO5)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     421450 (XPO5)
SSDB
Motif
Pfam: Xpo1 IBN_N HOOK_N Sec3_C
Other DBs
NCBI-GeneID: 421450
NCBI-ProteinID: NP_001264581
CGNC: 7870
Ensembl: ENSGALG00000010341
UniProt: F1NBL6
Position
3
AA seq 1206 aa
MSAEQVSSLCEQLVKAVTVIMDPASTQRYRLEALKFCEEFKEKCPICVPCGLKLAEKTQT
AIVRHFGLQILEHVVKYRWNNMPRLEKVYLKNNVMGLISSGTQSILEEESHIKDVLSRIV
VEMIKREWPQHWPDMLKELDTLSKQGETQTELVMFILLRLAEDVVTFQTLPTQRRRDIQQ
TLTQNMEKIFSFLLTTLQQNVNKYRRMKTDLAQQPKAQANCRVGIAALNTLAGYIDWVAL
SHITADNCKLLEMLCLLLNEPELQIGAAECLLIAVSRKGKLEDRKPLMVLFGDVAMHYIL
SAAQTADGEGLVEKHYVFLKRLCQVLCALGSQLCALLGSDSEVETPANFGKYLDSFLAFT
THPSQFLRSSTQITWGALFRHEVLSRDPLLLAMIPKYLRASMTNLVKVGFPSKSDSPSCE
YSRFDFDSDEDFNAFFNSFRAQQGEVMRMACRLDSRTGFQMAGEWLKYQLTAPVDTGPMN
SKTGEGLCSIFSPSFVQWDAMTFFSESVISQMFRTLDKDEIPVNDGIDLLQLVLNFETKD
PLILSCVLTNVSALFPFVTYRPEYLPQVLSKLFASVTFEVVEESKFVVSVQAPRTRAVKN
VRRHACSSIIKMCRDYPQLVLPNFEMLYNHVKQLLSNELLLTQMEKCALMEALVLISNQF
KDYERQKAFLEELMAPVAGLWLSAEMQRVLSDPEAFISYVGADNKIADPVMEDPSGLNRS
RISFCVYTILGVVKRARWPAAMEEAKAGGFLVGYLPSGSPIYRNPCTEQVLKLFDNLLAL
IRTHNNLYMPEMVAKLGETFAKALDMLEVEKNAILGLPQPLLELYDSPVYKTVLERMQGF
FCTLYDNCFHILGNAGPSMQQDFYTVEGLAAQLINSAFINLNNIPDYRLRPMLRVFVKPM
VLSCPPEYYETLVCPMLGPLFTYLHMRLSQKWEVINQRSILCEDDAADDNPESQEMLEEQ
LVRLLTREVMDLITVCCVAKRGAEHNSSVAVDGDDDEAMATDVTPPASAELTELGKCLMK
QEDVCTALMITAYASLSWKDTLSCQRTTTQLCWPLLKQVLPGNLLPDAVSWFFTSVLKGL
QIHGQHDGCMAALVHLAFQIYEALRPRYAELKVVMEQIPDIQRDSLEQFDSKLLNPTLQK
VADKRRKDHFKRLITGCIGKPLGEQFRKEVHIRNLPSLFKKVKPSLETDVLETNEDGEDL
TVLFEP
NT seq 3621 nt   +upstreamnt  +downstreamnt
atgtccgccgagcaggtgagcagcctgtgcgagcagctggtgaaggccgtcacggtgatc
atggacccggcctccacgcaacgctaccgcctggaggcgctcaagttctgcgaggagttc
aaggagaagtgccctatctgcgtgccctgcgggctgaagctggctgagaagacgcagacg
gccatcgtccggcacttcggcctgcagatcctggagcatgtggtcaagtaccgctggaac
aacatgcctcgtctggagaaggtttacctaaagaataatgtcatgggtctcatatccagt
ggaactcagagcattctagaggaggaaagtcacattaaggatgttctgtctcgcattgtg
gtggagatgattaagcgtgaatggcctcagcactggcctgatatgctgaaggagctggat
actctctccaagcaaggggaaactcagacagaactggtgatgttcatcctcctacgtttg
gcagaggatgtggtgactttccaaaccctgcctacccaacggcggcgagatatccagcaa
accctcacccagaatatggagaagatcttcagcttcctactaactaccctgcagcagaac
gtcaacaagtacaggcgcatgaagactgatctggctcagcagccaaaggcccaagcaaac
tgccgtgtggggatagcagcactcaacaccctggctggctacattgactgggttgccctg
agccacatcacagcggacaactgcaagctcttggagatgttgtgtctgctcctgaatgag
cctgagctccaaataggagcagcggagtgtctcctaattgctgtcagcagaaaagggaag
ctggaggatcggaaacctctgatggtgttgtttggagacgttgccatgcactacattctc
tctgctgcccagacggcagatggtgaaggcctggtggagaagcactatgttttcttgaag
agactttgccaagtgttgtgtgcactgggcagccagctgtgtgcattgctaggttcagat
tctgaagtggaaacacccgccaactttggaaaataccttgactcatttttagccttcaca
actcaccccagccagtttctgcgatcttccacccagattacgtggggagccctatttcgg
catgaggtcctgtctcgcgaccccttgttgctggctatgatccccaagtatcttcgtgca
tctatgaccaacctcgtgaaggtgggctttccctctaaatcagacagccccagttgtgaa
tactctcgttttgatttcgacagcgatgaggacttcaatgccttcttcaactctttccga
gcccagcaaggagaagtgatgaggatggcttgtcgtctggactctcgaactggcttccaa
atggctggggaatggctaaagtaccagctcacagctcctgttgatactggacccatgaac
tcgaagacaggcgaaggtctctgctccatcttctctccatccttcgtgcagtgggatgcc
atgaccttcttctcagagagcgtcatcagccaaatgtttcggaccctggataaagacgaa
atcccagtgaatgatggcatagatctactgcagcttgtccttaattttgaaacaaaggat
cctctcatcctgtcctgtgtgctcaccaatgtctctgctctattcccatttgtcacttac
cgaccggaatacctcccacaagtactttccaagctgtttgcttcagttacctttgaagtc
gtagaagaaagtaagtttgttgtgtctgtccaggctcctagaactcgagcagtgaaaaat
gtgagaaggcatgcatgctcctctatcataaagatgtgtcgggattaccctcagcttgtc
ctgcccaacttcgagatgttgtacaaccatgtgaagcagctgctctccaatgagctactt
ctgacacagatggagaagtgtgcccttatggaggcacttgtcctcatcagcaaccagttc
aaggactatgagcggcagaaagctttcctggaggagctcatggcccctgttgctggctta
tggctctccgcggagatgcagagagttctctcggatcctgaagcctttatctcctatgtg
ggtgcagacaacaaaatagctgatccagtcatggaagatcctagtggcctgaaccgttct
agaataagcttttgtgtatacaccattctgggagttgtgaaacgagctcgctggcctgca
gctatggaagaggcaaaagctggaggattcctggttggatacttgcccagtggaagtcca
atctaccgcaatccctgtactgagcaagtcctgaagctttttgacaacttactcgctctt
ataaggactcacaacaatctctacatgccagaaatggtggctaagctgggggaaacattt
gcaaaagccctagacatgctggaggtagagaagaacgccatcctaggtctccctcagcct
ctattggagctttatgactctcctgtttacaaaacagtcttagaaaggatgcagggtttc
ttttgtaccctctacgataactgtttccacatactgggaaatgcaggcccatccatgcag
caggatttctacacggttgagggtcttgctgcccagctcatcaactcagctttcatcaac
ctcaacaacattcccgattacagattgcgacctatgctccgtgtgtttgtgaagcccatg
gtactctcttgccctccagaatactacgaaacccttgtctgccccatgctgggaccactc
tttacctatctgcacatgaggttgtctcagaaatgggaagtgatcaaccagcgaagcatt
ctctgtgaggatgatgctgcagatgacaacccggagtctcaggagatgcttgaggagcag
ttggtcaggctgctgacccgagaagtcatggatctcatcactgtttgctgtgttgctaag
agaggtgctgagcataactcttctgttgctgtggacggagatgatgatgaagcgatggcc
acggatgtgactcctcctgccagcgcagagctgacggagcttggaaagtgtctgatgaag
caggaggatgtttgcactgctctgatgatcactgcctatgcatccctctcctggaaagac
accttgtcctgccaaagaaccacaactcagctttgctggccgctgctcaaacaggtgctt
ccaggcaatttgctgcccgacgccgtgtcctggtttttcaccagtgtgctgaagggctta
cagatccacgggcagcacgatggctgcatggcagctctcgtccatctggctttccagatc
tacgaggccttgcgtcctcgctatgctgagctgaaggtggtgatggagcagatcccagac
atccagagggactcgttggagcagtttgattcaaagcttcttaacccaacgctgcagaaa
gtggcagacaagcgccggaaagatcatttcaaacgcctcataacgggttgcattgggaag
ccacttggggagcagttccgcaaggaggttcatatccggaacctcccatctctcttcaaa
aaggtgaagccgtcactggagacagatgtgctggagacaaatgaggatggagaggatctc
actgtgctctttgagccctga

DBGET integrated database retrieval system