KEGG   Gallus gallus (chicken): 421461
Entry
421461            CDS       T01006                                 

Gene name
LTBP1
Definition
(RefSeq) latent-transforming growth factor beta-binding protein 1 precursor
  KO
K19559  latent transforming growth factor beta binding protein 1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    421461 (LTBP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:gga04990]
    421461 (LTBP1)
Domain-containing proteins not elsewhere classified [BR:gga04990]
 EGF-like domain-containing proteins
  hEGF / cEGF domain-containing proteins
   421461 (LTBP1)
SSDB
Motif
Pfam: EGF_CA cEGF TB EGF hEGF EGF_3 FXa_inhibition EGF_MSP1_1 Plasmod_Pvs28
Other DBs
NCBI-GeneID: 421461
NCBI-ProteinID: NP_001269537
CGNC: 51489
Ensembl: ENSGALG00000010448
Position
3
AA seq 1353 aa
MDTKVVCLLFFFSLPPLTVGNHTGRIKVVFTPSICKVTCTKGNCQNNCEKGNTTTLISEN
GHAADTLTATNFRVVICHLPCMNGGQCSSRDKCQCPPNYTGKLCQIPVQNGNTPKLYHHP
QQVNKAVGSQIIHSTHTLPLTMSGQQGVKVKFPPNIVNIHVKHPPEASVQIHQVSRIDSA
STGQKSKVPQPGHPQVSYQGLPYQKTQKGHATYTNQQPIPHVFPVSVKTQLGRCFQETIG
TQCGKALPGLSKQEDCCGTVGTSWGFNKCQKCPKKPSYHGYSPMTECPQGYKRINATFCQ
DINECQLQGVCPNGECLNTMGSYRCTCKMGFVPDPTLSRCIADSPIVAEEKGPCYRFVSA
GKQCMHPLSVQLSKQLCCCSVGKAWGPNCEKCPLPGTAAFKEICPGGMGYTVSGPHRNKL
YHHPAVRVQPPVIGKTPITQPVAKGTSPPPLPAKEEPVEALTFSQKSEPDMAVQEVATAA
PDQELVSLDQEKQILEPGQPQLSPGISTINLHPQFPVVIEKTSPPLPVEVAPEVSTSSAS
QVIAPTQVTEINECTVNPDICGAGHCVNLPVGYTCICYEGYRLNDQQTKCSDINECNQTP
HLCSLGRCENTEGSFLCICQAGFMASEDGTDCIDFDECSRPHTCGEGFCINTVGSYRCEY
CDSGYQMNRRGECEDIDECTTPTTCPDAQCINAPGSYQCIPCRVGFRGWNGQCHDINECQ
YGNLCANGRCENIEGSFRCICGQGFKLSASEDQCEDIDECQDRSLCVNGRCRNTEGSFRC
VCSQGYVLSATGDQCEDIDECLQDSDICLGGNCMNTDGSYKCSCLDGFQQIANRGCQDIN
ECERSDLCSPHGECLNTDGSYQCICEQGFSVSADGRTCEDIDECVNGTVCGSHGFCENMD
GSYRCLCYQGYQDSQDGQGCTDVNECEMLSGVCGEALCENVDGSFLCLCSDENQEYDPMT
GQCRFRTSSELPIEPDQHEDGKKECYYNLNDANFCDNVLASNVTKQECCCTLGAGWGDNC
EIFPCPVFGTAEFTDLCPEGKGFIPSGESSYGLLAENYKDADECQLFGQEICKNGFCLNT
QPGYECYCKQGTYYDPVKLQCFDTDECQDPNSCIDGQCINTEGSYNCFCTHPMVLDATEK
RCIRPADSSEQTEETEVYQDLCWQHLSDDFVCSRPLVGKQTTYTECCCLYGEAWGMQCAL
CPMKESEDYAQLCNIPVPGSRRPYGQDALVDFEEHYTPETNPYFVEDRFLNSFEELQAEE
CGILNGCENGRCVRVQEGYTCDCFDGYHLDMAKMTCVDVNECNELNNRMSLCKNAKCINT
EGSYKCLCLPGYVPSDKPNYCTPLNSELDSELE
NT seq 4062 nt   +upstreamnt  +downstreamnt
atggataccaaagtggtctgtttacttttctttttttccttgcctccgctgacagtggga
aatcacactggtcgcatcaaggtggtctttacacccagcatctgcaaagtgacttgtacc
aagggcaactgtcagaacaactgtgagaagggaaataccaccaccctcatcagtgagaat
ggccatgctgctgacacgctgacagccactaacttccgagtagttatttgccaccttccc
tgcatgaatggaggccagtgcagttctagagataaatgccagtgccctcctaattacacc
ggcaaactttgtcagatccccgtgcagaatggcaatactccaaaactgtaccatcaccca
caacaagtgaataaggctgtaggatcacagattatccactcaactcatactttaccactg
acaatgtctggacagcaaggtgtaaaagtgaagttccctcctaacatagtgaatatccat
gtgaaacatccccctgaagcttcagttcagattcatcaagtttcaagaattgacagtgca
tcaacaggacaaaaatcgaaagtacctcagccaggacatccacaggtctcttaccaaggt
cttccgtatcagaagacccagaaaggacatgctacttacacaaatcaacaacccattcct
catgtgtttcctgtttcagttaaaactcagcttggacgctgcttccaggagactattgga
acacagtgtggcaaagcacttcctggcctttctaagcaagaagactgctgtggaaccgtg
ggtacttcctggggttttaacaaatgccagaaatgtcccaagaagccatcttaccatgga
tacagtcctatgacagaatgcccacaaggctacaagaggatcaatgctacgttttgtcaa
gatatcaatgaatgtcagttacagggagtgtgccctaatggtgagtgtttgaataccatg
ggcagctacagatgtacctgcaaaatgggatttgtgccagatcctaccctttcaagatgc
atagctgatagtcctatcgttgctgaagagaaaggaccctgctaccggtttgttagtgca
ggaaagcaatgcatgcatcctctttctgtgcagctcagcaagcagctttgctgttgcagt
gttggaaaagcctggggcccaaactgtgagaagtgcccccttccaggaacagctgctttt
aaggaaatctgccctggtggaatgggttatacggtttctggccctcacagaaacaagcta
tatcatcaccctgcagttagagtacagccacctgtcattggcaagaccccgattactcaa
cctgttgctaaaggtacttctcctccacctctcccagcaaaggaagagccggtggaggca
ctgaccttctcacagaaaagtgagcctgacatggctgtgcaagaagtggcaactgcagcc
cctgatcaggaattagtttcacttgatcaagaaaagcaaatactagagcctggacagcct
cagctttctcctggaatttcaacaattaacctgcatccacagtttccagtagtgattgag
aaaacatctccgcctctgcctgttgaagttgctcctgaagtctctacttcgagtgcaagt
caagtaattgcacctactcaagttacagaaatcaacgagtgtacagttaatcctgatatc
tgtggagcaggacactgcgttaatttgcctgtgggatacacctgcatctgctacgaggga
tacagacttaacgatcagcagacaaaatgctctgatattaatgagtgtaatcagacacct
catctctgttcccttggacgctgtgaaaatactgaaggaagtttcctatgtatttgccaa
gctggattcatggccagtgaagatggaactgactgcattgattttgatgaatgttcacgg
cctcatacttgtggggaaggtttctgtataaatactgttggctcgtataggtgtgaatat
tgtgacagtgggtaccagatgaacaggagaggtgaatgtgaagacattgatgaatgcaca
accccaactacttgtccagatgcacagtgtattaatgctcctggctcttaccagtgcata
ccctgcagagtgggattcagaggctggaatggacagtgccatgacataaacgaatgtcaa
tatggcaatctctgtgcaaatggacgttgtgaaaatattgaggggtctttcagatgtatt
tgtggccaaggtttcaaactctctgcatcagaggatcagtgtgaagatatagatgaatgc
caagacagatccctgtgtgtcaatggacgctgcaggaacacagaagggtctttcagatgt
gtttgtagccaaggttacgttctgtctgctactggagatcagtgtgaagatattgatgaa
tgccttcaagacagtgatatttgccttggaggaaactgcatgaataccgatgggtcgtac
aaatgctcttgcctagatggttttcagcagatagccaacaggggatgtcaagatatcaat
gaatgtgagagatctgacctctgttcacctcatggagagtgtctaaacacagatggttcc
taccagtgcatatgtgagcagggcttttctgtgtctgcagacggccgaacctgtgaagat
atcgatgaatgtgtgaatggcacagtgtgtggcagccacgggttctgtgaaaacatggac
ggctcctaccgctgcctctgttaccagggctatcaggactcacaggatgggcaagggtgt
acagatgtgaatgaatgtgaaatgctgagcggggtttgtggcgaagccctctgtgaaaac
gttgatggttctttcctgtgcctgtgttctgatgaaaaccaggagtacgatcccatgacc
ggacagtgtcgcttccgtacctcatcagaattgccaatagagcctgatcaacatgaagat
ggaaagaaggagtgctactacaatctgaatgatgctaacttctgtgacaatgtgcttgcg
tccaatgtaaccaaacaagaatgctgctgtactttgggtgctggctggggtgataactgt
gaaatcttcccatgccctgtctttggaactgctgaattcactgatttgtgtcctgaaggg
aaaggcttcattccctctggagaatcatcttacgggcttcttgccgagaattacaaagat
gctgatgaatgccagctctttggacaagaaatctgtaaaaatggcttctgtttgaataca
cagccaggttatgagtgctactgcaaacaaggcacatactatgaccctgttaagctccag
tgctttgacacggatgaatgtcaggacccaaacagctgtattgatggccagtgcattaac
acagaaggatcttacaactgtttctgtacacacccaatggttttggacgcaacagaaaag
cgatgcatcagaccagcagattcaagtgaacaaactgaagaaactgaggtctaccaggat
ctttgctggcagcatctaagtgacgattttgtttgtagtcgacctctggttggaaagcag
actacatacactgagtgctgttgcttgtatggtgaagcctggggcatgcagtgtgccttg
tgtccgatgaaggaatcagaggattatgcccagctgtgcaacattcctgttccaggatct
cgacggccatatggacaagatgctttggttgactttgaggagcactacactccagaaact
aatccatactttgtcgaagaccgttttctgaacagctttgaggagttacaggcagaggaa
tgtggtattctaaatggatgtgaaaatggccgatgtgtgagagtgcaggagggctacacc
tgtgactgctttgatggttatcacctggacatggccaagatgacttgtgttgatgtgaat
gagtgcaatgagctgaacaacaggatgtctctctgcaagaacgccaaatgcattaacaca
gaaggttcgtacaagtgtttgtgtctcccagggtacgtaccttcagacaagccaaactac
tgcacaccactgaactcagaactagacagtgaactggagtag

DBGET integrated database retrieval system