KEGG   Gallus gallus (chicken): 421543
Entry
421543            CDS       T01006                                 

Gene name
AGT
Definition
(RefSeq) angiotensinogen
  KO
K09821  angiotensinogen
Organism
gga  Gallus gallus (chicken)
Pathway
gga04080  Neuroactive ligand-receptor interaction
gga04261  Adrenergic signaling in cardiomyocytes
gga04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    421543 (AGT)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    421543 (AGT)
   04270 Vascular smooth muscle contraction
    421543 (AGT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gga01002]
    421543 (AGT)
Peptidases and inhibitors [BR:gga01002]
 Peptidase inhibitors
  Family I4: serpin family
   421543 (AGT)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 421543
NCBI-ProteinID: XP_004935550
CGNC: 8441
Ensembl: ENSGALG00000011117
UniProt: F1NDH2
Position
3
AA seq 464 aa
MKLAAGLLCLLLCFTAVGCDRVYVHPFSLNAINESACEELERLAQEGKKTFVPASIESQT
TPAYEEDVKDEVRLDSPSLSVRGRQKLIYLKDFVHVLGMRFYNLQREARQGQNVLLSPTS
LYGSLASFYLGASNQTAADLQGLLGFVPPSGDSNCTSRVDGRKLLESLRTIESLVKTQDE
ELLFSKVFCLFSAPGILLSQQFVHNLLPSADAFYTRAVDFTNPSEATKQINAFVEAKSKG
QSKHLLTDLDPTTDLLVAVDVRLAANAKKASWLKEPQEFWVDSNRAISVPMLSVTGMFKY
MTDTSETFSATEIPVGKNVLLVLLQPINGNDLDKVEAKLPLQSSAWLENLSPRKIKLTLP
EFRIEDSSDLQEFLADMKLPALLGKEADLSKISDTHLTVGKIMNKAFFKLSSDATHQPED
ATAQEEDSVPQEVMLNKPFLLAVFEAKSRAMLFLGRVTNPLQEV
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgaagctggcagcaggtcttctctgcttgctcctgtgcttcactgcagtgggttgtgac
cgggtctacgtccaccctttcagtttgaatgctatcaatgagagtgcctgtgaggagctg
gaacgcttggcccaggaaggaaagaaaacatttgtgcctgcctccattgaatcccaaacc
acacctgcctatgaagaggatgtgaaggatgaagtcaggctggactcccctagcctaagt
gtccgtggaaggcagaaactgatctatctgaaggactttgtgcacgtccttggcatgcgg
ttttacaatttgcagagggaagcacggcagggccaaaatgtcctcttgtcccctaccagt
ctctacggctccttggcatctttctacttgggtgcatccaaccagacagctgctgatttg
cagggtttgctgggatttgttcccccctctggagactccaattgcacctccagggtggat
gggcgcaagctccttgaaagtctaaggactattgaaagccttgtcaaaacccaagacgag
gagctgctcttttccaaggtgttctgcctcttctctgcccctggcatactcttatcccaa
cagtttgtgcataacttgctcccctctgctgatgctttttacacacgagctgtggacttc
acaaacccaagtgaggcaacgaaacaaataaatgcctttgtggaggccaaaagcaaaggc
caaagcaagcacttactgacagacctcgacccaactactgacttactggttgcagtggat
gttcgcttggcagcgaatgctaagaaagcctcttggctgaaagagcctcaggagttctgg
gttgattcaaacagggcgatctcagtccccatgctgtcagtaactgggatgttcaagtac
atgactgacaccagtgagaccttttctgcaaccgaaatccctgttggcaagaacgttctg
ctggtgctgctgcagcccatcaacggcaatgacctggacaaagtagaggccaagcttcct
ttgcagtcatcagcctggcttgaaaatctgtccccaagaaaaattaaattaactttgcct
gagttcagaatagaagacagctctgacctacaagaatttcttgcagatatgaaactgcct
gcgctgctggggaaggaagcagacctcagtaaaatcagtgacacccacctcactgttgga
aagataatgaataaagcctttttcaaactgagcagtgatgcaacacatcaaccagaagac
gccacagcgcaggaagaagattcggtgccccaggaagtaatgctgaacaaaccttttctt
ctagcagtttttgaagcaaagtcaagggcaatgcttttccttggtagagtaacaaaccca
ctgcaggaggtttaa

DBGET integrated database retrieval system