KEGG   Gallus gallus (chicken): 421564
Entry
421564            CDS       T01006                                 

Gene name
AFDN
Definition
(RefSeq) afadin isoform X1
  KO
K05702  afadin
Organism
gga  Gallus gallus (chicken)
Pathway
gga04520  Adherens junction
gga04530  Tight junction
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    421564 (AFDN)
   04530 Tight junction
    421564 (AFDN)
SSDB
Motif
Pfam: RA DIL PDZ PDZ_6 FHA PDZ_2 Yop-YscD_cpl
Other DBs
NCBI-GeneID: 421564
NCBI-ProteinID: XP_015139830
CGNC: 51504
Ensembl: ENSGALG00000011329
Position
3
AA seq 1925 aa
MSGGGSREEERRKLADIINHWNANRLDLFEISAPTEDLEFHGVMRFYFQDKAAGNFATKC
IRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGEERRLDVDEKPLVVQLNWN
KDDREGRFVLKNENDTLPPKKAQSNGPEKQEKEGVIQNFKRTLSKKEKKEKKRREKEALR
QASDKDDRLLHGDDIENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFR
SSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVIEALEKYGLEKENPKDYCIA
RVILPPGAQHSDDKGAKETILDDDECPLQIFREWPSDKGILVFQLKRRPPDYVPKKSKKI
ADGKPLKGKERVDGSGYGSCLPPEKLPYLVELSPGRRNHFAYYNYHAYEDGSDSRDKPKL
YRLQLSVTEVGTEKFDDNSIQLFGPGIQPHHCDLTNMDGVVTVTPRNIDAETYVEGQRIS
ETTMLQSGMKVQFGSSHVFKFVDPTQDHIITKRPIDASLMVKGPRHKAGAVQETTFDLEG
DVHSGTALPASKSTSRLDGDRTSSASSTAERGMVKPMIRIEQQQDYRRQESRPQDTHGPE
LILPASIEFRESSEDAFLSAIINYTNSSTVHFKLSPTYVLYMTCRYVLSSQYRPDITPTE
RTHKVIAIVNKMVNMMEGVIQEVDQVDQKQKNIAGALAFWMANASELLNFIKQDRDLSRI
TVDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFLDDPEENNPQRPKIDDVLHTLTGAMS
LLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTAPDSGLCSHYWGAIVRQQLGHIEAWAE
KQGLELAADCHLSRIVQATTLLTMDKYSHADVPNINSTCFKLNSLQLQALLQNYHCAPDE
PLIPTELIENVVTVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCDVVRNVPSG
LQEFLDPLCQRGFCRLIPHTRSPGTWTIYFEGADYESHLSHENAELAQPLRKEPEIITVT
LKKQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQ
ERAAELMTRTGSVVTLEVAKQGAIYHGLATLLNQPSPMMQRVSDRRGSGKPRPKSEGFEL
YNNSTQNGSPESPQLPWTEYSEPKKLPGDDRLMKNRADHRSSPNVANQPPSPGGKNAYAS
GTTTKITSVSTGNLCTEEQTLPPRPEAYPIPTQTYTREYFTFPASKSQDRMGPAQSQWPN
YEEKPQIQAESNHSINTTMQRVARSQEELRDKVFQPERNRLEVVIRKDIEYIDRKSDSDQ
WMNSSVDSSTSSQEHLNHTSKPVSPGSCLTKSGPGRWKTPATSQPTPVAVSQPIRTDLPP
PPPPPPVHYAAEFDEPQMDLPLPPPPPPNQVGAQASSQVAAAERKKREEHQRWYEKEKAR
LEEERERKRREQERKLGQMRSQPLIPPQPVVPPVSLQQVKSEKTSTFQRSQETVIRELQP
QQQPRTIERRDLQYITISKEELSSSDSLSPDPWKRDAKEKLEKQQQMHIVDMLSKEIQDL
QNKPDRTAEENDRLRKLMLEWQFQKRLQESKQKDEDDDEEEDDDVDTMLIMQRLEAERRA
RQTAVPAISVLDLLQDEERRRQQQLEEMRKREAEDRARQEEERRQQEEERTRREAEEKRR
QEEEYYNRLEAERRRQHDEAERRLLEPDEPGLYRPPLPREYELPSPTPSSNAPPPPPQRN
TSYLKTQVLSPDTIYTAKFVAYNDDEEEEDSNLAGQDKYSSTRKSYGDFPPATLKPQQPS
RQPRPVSDGLFLSNSFQSSPVNANSTAAKKSQPPPPPNKPSFIHASSSKGINSYTGSSGA
TVGAHEVYRDPRDKRSKSQDTDLPGAPENLTFRERQRLFSQGQDVSNKVKASRKLMELEN
ELNTK
NT seq 5778 nt   +upstreamnt  +downstreamnt
atgtcgggcggcggcagccgggaggaggagcggcgcaaactcgccgacatcatcaaccac
tggaacgcgaaccggctggacctgttcgagatcagcgcccccaccgaggatttggaattt
catggtgtaatgagattttactttcaagacaaagcggctggaaactttgcaacaaaatgt
atccgtgtctcaagtactgccacaactcaggatgtgatagagactcttgcagagaagttc
cggccagacatgcgcatgttgtcatcccctaaatactcgctctatgaggtgcatgtcagt
ggagaagaaagaagattagatgtggatgagaagcctcttgttgtacaattaaactggaac
aaagatgatcgagaaggaaggtttgttctcaagaatgaaaatgatacgcttcctccaaag
aaggctcagagtaatggccctgaaaaacaagaaaaagaaggagtaatacagaatttcaaa
cgaactctctcaaagaaagaaaagaaagagaagaagaggcgtgaaaaagaggcattgcga
caagcatcagataaagatgatcgacttcttcatggggatgatattgagaattctcgcctt
gcagctgaggtttacaaagatatgcctgagaccagcttcactcgcacaatatctaatcct
gaggtggttatgaaacgacggcggcagcaaaaactagagaagagaatgcaggaatttcgc
agttctgatggcagaccagactcaggtgggacgctgagaatttatgcggacagtttaaaa
ccaaatataccatacaagacaatcctgttgtcaactacagatactgcagactttgcagtt
attgaagcactggagaaatatggcttggagaaggaaaaccccaaggattattgtattgct
cgtgtcattctgcctcctggtgctcagcactctgatgataaaggtgctaaagaaactatt
ctagatgatgatgagtgtccacttcagatattcagggaatggcctagtgataaaggaata
ctagtctttcagttgaaaaggcggcctcctgattatgtcccaaagaaatccaagaaaata
gctgatggaaagccattaaaggggaaggaaagagttgacgggtctggctacggctcttgc
cttcctcctgagaaactaccatacctggtagaattaagcccagggagaaggaatcacttt
gcctactacaactatcacgcttatgaagatggttctgactccagagataaaccaaagctt
tatcgtctacaattaagtgtcactgaagttggaactgaaaaatttgatgacaattccatt
cagttatttggtccaggaattcagcctcatcattgtgatcttactaatatggatggagtt
gttactgtaaccccaagaaacattgatgcggaaacgtatgtagaaggtcagcgtatttca
gaaaccactatgctgcaaagtggaatgaaggttcagtttgggtcatctcatgtgtttaag
tttgtggatcccactcaggaccatattattactaaaagacctattgatgcaagccttatg
gtcaaaggtccaaggcataaagctggagctgttcaggaaaccacgtttgatctggaggga
gatgttcacagtggaacagcgttaccagcgagcaagagcaccagcaggcttgatggtgac
agaacatcatcagcatccagcacagctgaacgaggaatggtgaagcccatgattagaata
gaacagcagcaagattatcgcagacaggaaagcagacctcaggatacccatggaccagaa
ctgatcctacctgccagtattgaattcagggaaagctctgaagatgccttcttatctgcc
attataaattatacaaatagctcgacagttcattttaaactgtcacccacgtatgttttg
tatatgacatgtcggtatgtattgtcaagccagtacagacctgacatcactcctactgag
cgtactcacaaagttattgcaatagtcaacaagatggtgaatatgatggaaggagtcata
caggaggtagaccaggttgatcagaaacagaagaatattgctggggcacttgccttttgg
atggcaaatgcgtctgaattgctgaattttataaagcaagaccgtgatctgagccgaatc
actgtggatgctcaagatgttttggcgcacttggttcaaatggcattcaagtacctagtt
cattgtctgcagtcagagcttaataactacatgccagcatttcttgatgatccagaggaa
aataatccacagaggcctaaaatagatgatgtgctgcacacattgactggagctatgtcc
ttgttgcgacgatgtagagtgaatgctgcactgactatacagctcttctcccagttgttt
cattttatcaacatgtggctttttaacagactagttacggctccagattcagggttatgt
tcccactactggggagctattgttcgtcagcagttgggtcatattgaggcctgggcagaa
aaacagggtttagaattggctgctgattgccacttaagcagaatagtgcaggcaaccaca
ttgctcaccatggacaagtactcacatgctgatgttccaaatattaacagtacttgcttt
aagttgaattctctacagctacaagctttgttgcagaattatcactgtgctccagatgaa
ccgcttataccaacagaactgatagagaatgtagtaactgttgcagaaaatacggctgat
gaacttgctcgcagtgatggcagagaagtccaattggaagaggatcctgacttacaactc
ccttttcttttaccagaagatggctattcctgtgatgttgtcagaaatgttccaagtggt
ttacaagaatttttggatcccctctgtcagagaggtttttgtaggttaatacctcataca
cggtcaccaggcacatggacaatatactttgaaggcgcagactatgaaagccacctgtca
catgagaatgctgagctagctcagcctttgaggaaagaacctgagattataactgtaaca
ctaaaaaaacaaaatggaatgggcctcagcattgttgctgccaagggtgctggtcaagac
aaacttggaatatatgtcaagtctgttgtgaaaggaggtgctgcagatgtggatggtcgt
ctggcagcaggggatcagctgctcagtgtggatggtcgaagcttggtggggctgtcccag
gaaagggcagcagaacttatgacgaggacaggttctgttgtaacactggaagtagcaaaa
caaggagcaatataccacggtctggcaaccctgctaaatcagccatctccaatgatgcaa
agagtttctgaccgccgtggctcaggtaaaccccgaccaaagagtgaaggttttgagctg
tataacaactccacgcaaaatgggtcacctgagagcccccagctgccatggacggagtac
agtgaaccaaagaagctgccaggagatgacagattaatgaagaacagagccgatcatcgc
tccagccccaacgtagcaaatcagcctccaagccctggggggaagaatgcttatgcatct
ggaactaccaccaaaataacctcagtctcgactggaaatctttgtacagaggagcaaact
ctgcctccacgacctgaagcttatcctatcccaacacagacctataccagagaatatttc
acattcccagcttcaaaatcccaggatcgaatgggtccagctcagagtcagtggccaaat
tatgaagagaagccacagatccaggcagaaagtaatcactcaatcaatactacaatgcag
cgcgtggctcgatcccaggaagaactccgagataaagttttccagccagagaggaatcgt
ttggaagttgttatccggaaggacatagaatacattgatcggaagtcagacagcgatcag
tggatgaattcatctgtggattctagcacatctagccaagagcacctgaaccatacatcc
aaacctgtttcacctggttcttgcttaactaaaagtggacctggccgttggaaaactcca
gctacgagccagccaactccagtggccgtttcccagcccatcagaacagaccttcctcct
ccgccgccacctcctccggtgcattatgcagctgaatttgatgaaccacaaatggatttg
cctctgcctccccctcctccaccgaaccaagtaggagcacaagcatcttctcaggtggct
gctgctgagcgtaaaaaacgagaagagcatcagaggtggtatgaaaaggaaaaggcacgt
ttggaagaagaacgagaaaggaaacgccgtgagcaagagagaaaactgggccaaatgcgt
tcgcagccactaattcctccccagcctgtggttcctcctgtttcccttcagcaagtgaaa
tcggaaaaaacttcaactttccagaggtctcaagaaacagtcattcgagagttgcagccg
caacagcagcctcggactattgagcggagagatctgcagtacattactatcagcaaggaa
gaattgtcctctagtgacagcctctctccagatccctggaaacgagatgccaaggagaaa
ctggagaagcagcagcagatgcacattgtggacatgctgagcaaagagattcaggatctt
cagaacaagcctgatcgtacagctgaagagaacgaccgcctgcgcaaactcatgctagag
tggcagttccaaaagcgacttcaggaatcaaaacaaaaggatgaagatgatgatgaagaa
gaggacgatgatgtggatactatgcttatcatgcagcggctggaggcagaaagaagagca
aggcagactgctgtgccagcaatctctgttctagacttgttacaggatgaagaacgcaga
cgacagcaacagttagaagaaatgcgcaagcgagaagcagaagacagggccaggcaggaa
gaggagcgccgacagcaagaggaggagcgaaccaggagagaggcagaagaaaagaggcga
caggaagaggagtattacaatcgcttagaggctgaaaggcgcaggcagcacgatgaagca
gaacgaagattgctggaaccagacgagcctggtctgtacagacctccacttccacgggaa
tatgaactcccatccccaaccccttcatctaacgctcctcctcccccacctcagcgaaac
acctcttacctcaaaacacaggtcctctcccctgacacgatttatactgccaagtttgtt
gcatacaatgatgatgaggaggaggaggattccaatctagcaggtcaggataagtactcc
agcacaagaaaatcttatggtgactttcctcctgccacccttaaaccacagcagccctcc
cgccagcctcgcccagtttcagatggcctctttctttccaactcattccagtcatctcca
gtcaatgccaacagtactgctgccaaaaaaagccagcccccgcccccaccaaacaaaccg
agtttcatccatgccagcagctctaaaggaataaattcatacactggatcttcgggagca
acggttggggcccatgaagtctatcgggatccaagagacaaacgatctaaaagtcaagat
acagatttacctggagcaccagaaaatctgacgttcagggaacgccagcgacttttttca
cagggtcaagatgtatccaataaagtaaaagcctctaggaaactaatggaactggaaaat
gagttgaacacgaaataa

DBGET integrated database retrieval system