KEGG   Gallus gallus (chicken): 421583
Entry
421583            CDS       T01006                                 

Gene name
SLC22A2
Definition
(RefSeq) solute carrier family 22 member 2 isoform X1
  KO
K08199  MFS transporter, OCT family, solute carrier family 22 (organic cation transporter), member 2
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gga02000]
    421583 (SLC22A2)
Transporters [BR:gga02000]
 Solute carrier family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   421583 (SLC22A2)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    421583 (SLC22A2)
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 421583
NCBI-ProteinID: XP_015139803
CGNC: 51507
Ensembl: ENSGALG00000011615
UniProt: F1NVE0
Position
3
AA seq 589 aa
MPTLDDVLEHIGEFDRFQKQTFFVLCLLSAAFTPVYVGVVFFGFTPEHRCFSPGVVELSQ
RCGWSLAEQLNHTVPEWGSHGAAYSSRCSRYEVDWNATGVSCTDPLGSLVGNWSSVPLGP
CQDGWVYDYPGTSIVTEFNLVCEDSWKLDLFQSSVNVGFFIGSVIIGYMADRFGRKLCLL
ITVLINSVSGVLVAFAPSYTWTVIFRLIQGLVSKGGWLTGYVLTAEFVGLSFRRTVGIIY
QLAFTVGLLILTAVAYVLPHWRWLQLAVTLPNFFFLLYHWCLPESPRWLITQKQNDKAME
VIKRIAKNNKKQLPPSFQNLKSEDEDGEKLKPSYLDLVRTPQIRKHTFILMYSWFTSSVL
YQGLIMHMGLASGNIYLDFLYSALVEFPAAFILLLTVDRIGRRYPWAVANVMTGGACVVT
ALVPDTLYWLKMTAACLGRMGITMCFEMVCLVNPELYPTSLRNLGVLVCSSMCDIGGIMT
PFIVYRLAELWHELPLVVFAGIAVVGGGLVLLLPETKGKTLPETIEDAENMHRYGASSTD
QSSFPSLQQSPLVAIHHQKYRWGPDRTWPGQKVNATRHRTGGEEVVSRS
NT seq 1770 nt   +upstreamnt  +downstreamnt
atgccaaccttggatgacgttttagagcacattggagaatttgacaggttccagaaacaa
accttcttcgtcctgtgtttgctttctgctgccttcactccagtctacgtgggtgtcgtc
ttcttcgggttcacccccgagcaccgctgcttcagccctggtgtggtggagctgagccag
cgctgtggctggagcctggcggagcagctgaaccacaccgttcccgagtggggcagccat
ggggccgcctacagcagccgctgcagcaggtatgaggtggactggaacgcaacgggtgtc
agctgcaccgacccccttggcagccttgtgggcaactggagctccgtcccgcttggcccc
tgccaagatgggtgggtctacgactaccctgggacctccatagtgaccgagtttaacctc
gtgtgtgaggactcctggaagctggacctctttcagtcatctgtgaacgtcgggttcttt
attggctccgtgatcattggctacatggcagataggtttggccgcaagctctgcctcttg
atcacagtcctcatcaattctgtctcaggggttctcgtggccttcgcacccagctacacg
tggacagtgatctttcggttgatccaggggctggtcagcaaggggggctggctgacaggc
tacgtcctgactgcagaatttgttggcttaagcttccggaggacagtgggcatcatctac
cagcttgccttcactgtgggactccttatcctcactgccgtggcttatgtgctcccacac
tggaggtggcttcagcttgctgtcaccctgcccaatttcttcttcctactctaccactgg
tgtctgcccgagtcccccaggtggctaataactcagaagcaaaatgacaaagctatggaa
gttattaagcgcattgccaagaacaacaagaagcagctacctccctctttccagaacctc
aaatctgaagatgaagatggagaaaagctgaaaccttcatatctagacctggtcaggaca
cctcagataagaaagcacacgtttattttgatgtatagttggttcacaagttccgtcctc
taccaagggctcatcatgcacatgggactagctagtgggaacatttacctggatttcctc
tattccgctctggttgagttcccagctgccttcatcctcttgttaacagtggatcgcatt
ggccgtcgctacccatgggctgtggcaaatgtgatgacgggtggtgcctgtgttgttacg
gcgttagtcccagacactctttattggcttaaaatgaccgcagcatgcctgggcaggatg
ggaattaccatgtgctttgaaatggtttgtttggtaaatcctgagctgtatccaacttct
ctcaggaacctaggagtactggtctgctcatccatgtgtgacatcggtgggatcatgacc
cccttcattgtgtacagactggcggagctctggcacgagctgcctctggttgtctttgcc
gggattgctgttgtcggtggtggcttggtcttgctcctacctgagacgaagggaaaaact
ctgcctgagaccattgaagatgctgaaaacatgcacaggtatggtgcatcaagcacagat
cagagcagctttccttcactgcagcaaagccctcttgttgccattcatcaccagaagtac
cgttggggacctgacaggacctggcctggccagaaagtgaatgcaacacggcacaggaca
ggaggagaagaggttgtctctagaagttag

DBGET integrated database retrieval system