KEGG   Gallus gallus (chicken): 421632Help
Entry
421632            CDS       T01006                                 

Gene name
PLEKHG1
Definition
(RefSeq) pleckstrin homology domain-containing family G member 1 isoform X1
  KO
K23859   
Organism
gga  Gallus gallus (chicken)
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGEF PH PH_10 DUF406 IQ_SEC7_PH
Motif
Other DBs
NCBI-GeneID: 421632
NCBI-ProteinID: XP_004935669
CGNC: 9415
Ensembl: ENSGALG00000012395
UniProt: E1C7S5
Position
3
AA seq 1586 aa AA seqDB search
MPDKAPGGTEPVPRSEDNFHLPLDVLPAVTEALDSKTKGEDLHKESRPFHCCEKKTMDLS
DSDRPVSFSSTSSSASSRDSHCSFGSRMTLVSNSHLGLFNQEKEAGAIKLELVPARRFSS
NKPRKNIPTEQEDPEESLEKKLSTPRKAEPKGAGKNCAMSLVTEPTSPKLLYVDRVVQEI
LETERMYVQDLKSIVKDYLDCITDQSKLPLGTEERSALFGNIRDIYLFNSELLQDLENCE
NDPVAIADCFVSKSEDFHIYTQYCTNYPRSVAVLTECMRNKTLAKFFRERQEALQHSLPL
GSYLLKPVQRILKYHLLLHEIENHLDKDTEGYDVVLDAIDTMQRVAWHINDMKRKHEHAI
RLQEIQSLLTNWKGPDLTSYGELVLEGTFRIQRAKNERTLFLFDKLLLITKKRDEMFAYK
AHILCGNLMLVEVIPKEPLSFSVFHYKNPKMQHTVQAKSQQEKRLWILHLKRLILENHPA
KIPAKAKQAILEMDAIHHPGFHYSPEGETKSTYQPKEGATQQRVRRKSEPSSRVHKVLKS
NDISPDMQKRICIEGALLSQANKLGSNESLLNSRKKGSLESSGLESQFQGSAEPAYNSDQ
DENLQTSAAEQIDADDEEESEQGMQQNSLQKSKGGRKRLNSQAAENVEKRRSVNLSKCEM
QSSKDPSDEESSQLNTDLPFSCSARQSQSPRQFNTPQNNSLIMNILGGTTSVRNIWTDHQ
IRQALFPSRRPPYENEDDDDDYQMFMPSLSTSNSGSAVSGERRGHSDRPCSWHLGVVHQN
ETPSSNRHKIVRRASSAGESNTCPTIARCKISERSSRRDVKRTDVSSMNAYPESSEELTI
DDIEHVYDNISYEDLKLMGLTRREETHHGPQRSARDSLYEEENKSSLNSPSKKRTANQSR
TSLHASRDEILLGRDAATSSLDELRIVEDNVYDTIVLPETPLLKFKHDPLKCSKKRSFLG
LEKDLTCSDNLQQFVSEESLQFSEDESPYHRLPIDNDYLSLVDSSSNSDSLSHKSAADKL
SEEVDEIWNDLENYIKKNQEKTRDRHLAAFPVCKDDIQERLHAGSTPELSKDVEYSMSTL
SLPETPIFPKTVKPRAATVSEASLRLEDATACKESSLASLNRSSFLGEMPFVDSPYESAS
SVLSNTHTECMENDPAIVDKTKNRVFMMARQYSQKIKKANQLLKVKTPEQEQPASRQQKL
KHKDLAAILEEKKQGGPAIGARIAEYSQLYDQIVFRDSSPKVQKEAWASPQEPSAVRFST
PLASTLPCAQVTGECSRAEDWLLHSTYSNGELADFSPWPESQDTKSKSSYAEAVTKSNSR
QLPSACSVPSLQISNRLHVPAQRWSAIISQPNKENLHQDHIYNSLGRRVSSMKPQAYSRS
QSSSSIVVNRSGESIVCPNETDKKTPHSNRNFRLNSHQALGIASACTGPDMRKQIPENYS
DMILQDSQKVLRVNRPSPLTAQMATQNYFSNFKDTEEGEGDDDDYVEIRSEDEGSDLEAS
QNQTRKLDPKLHNTDTDPSETLCGKTVSCTPAKPTGSKHTLTPYLTAYSDSDKLNDYLWR
VPSPSQQNIVQSLREKFQCLSSSSFA
NT seq 4761 nt NT seq  +upstreamnt  +downstreamnt
atgccagataaggcaccaggtggtacagaacctgtccccaggagtgaagataacttccac
ttacctctagatgttttaccagctgtgacggaggcccttgactccaagacaaaaggagaa
gatctgcacaaggagagcagacctttccactgctgtgaaaaaaaaaccatggacctgtca
gacagtgaccgtcctgtcagctttagctccacttcctcctctgcctcctcaagggacagc
cactgttcctttggaagcaggatgacattagtttcaaacagccacttgggcctatttaac
caggagaaagaagcaggagccatcaagctggaattagtcccagccagaaggttttccagc
aacaagccacgcaagaatatccctacagagcaagaggatcctgaggagagccttgaaaaa
aagttaagcactccaaggaaggcagaaccaaaaggagcaggcaaaaactgtgcaatgtcc
ctggtgacagagcccaccagtcccaagctcctctacgtagacagagttgtccaagagatc
ctagagacagaaaggatgtatgtgcaggatctgaaaagcattgtgaaggattaccttgat
tgtatcactgaccaatccaaactgcccctggggactgaagagcgatcagccctgtttgga
aacatacgagatatctaccttttcaacagtgaacttctgcaagatttggaaaactgtgaa
aatgatcctgtggctatagcagactgtttcgtgtccaaaagtgaagatttccatatatat
acacagtattgcaccaactacccaaggtcagtggctgtgttgacagaatgcatgaggaac
aagacattggccaagttcttcagagaacggcaagaagcactgcaacattccttgcccctg
ggctcctatctcttgaaacctgtccagcgaatcctgaagtatcacctactcttgcacgaa
atagaaaatcaccttgacaaggatactgagggctatgatgtggtgctggatgccatagat
acaatgcaaagagtagcatggcacataaatgacatgaagaggaagcatgaacatgccatc
aggcttcaggagatacagagtttgctcaccaactggaaagggccagatctcactagttat
ggggagctggttctagaaggaacatttcgcattcagcgagccaaaaatgagcgcacgttg
ttcctctttgacaagctgctgctgatcacgaaaaagagagacgagatgtttgcatacaaa
gctcacatactgtgtgggaatcttatgctggttgaagtaataccgaaggaaccactcagc
ttcagtgtcttccactacaaaaatcccaagatgcaacatactgtccaggcaaaatcacag
caagaaaaacggctttggattcttcacttgaagaggctaattctagaaaatcatcctgct
aaaattcccgccaaggccaaacaggcaattctagaaatggatgccatacatcacccaggg
ttccattatagccccgagggagaaacaaaatcaacgtaccagcctaaagaaggcgctact
caacagagagtgagaaggaaatcagaaccctcatccagagtccataaagttttgaagtca
aatgacataagcccagatatgcagaagcggatctgtattgaaggagccctattatctcaa
gccaacaaactaggatcaaatgaatccctgctgaattctaggaaaaagggttcattggaa
tccagtgggctagagagccaatttcaagggtccgctgagccagcctacaacagcgatcag
gatgaaaatctccaaacatctgctgcagaacagattgatgctgatgatgaagaagaatct
gagcagggaatgcaacaaaattcactacagaaatcaaaaggaggaaggaaaaggcttaat
agtcaagctgctgaaaatgttgaaaaaaggagaagtgttaatctcagcaagtgtgaaatg
cagagctccaaggacccttcagatgaagagtcaagccagttgaatactgatctcccattt
tcctgttcagctagacagtcgcagtcacccagacaattcaacacaccccaaaacaactca
ctgattatgaatatcctgggaggaaccacctctgtcagaaacatctggacggaccaccaa
atcaggcaggcattgtttcccagccggcgtccaccttatgagaatgaagatgatgatgat
gattatcagatgttcatgccatcattgtctacatccaacagcggttcagctgttagtgga
gaaaggagaggtcactcagatcggccctgcagctggcacctgggggtagtgcatcaaaat
gaaactcccagctccaatcgtcataaaattgttcgacgggccagtagtgctggtgagagc
aacacgtgtccaaccattgccagatgtaaaatcagtgagcgcagttctcgaagggatgta
aaaagaacagacgtgagcagtatgaatgcatatcctgaatcttcagaggagctgaccatt
gatgatattgaacatgtttatgacaacataagctatgaagacttgaagctgatgggtctg
acaagaagggaggaaacacaccatggtccccagaggtctgctagagactctctttatgag
gaggaaaacaaaagcagcttaaattcaccctccaaaaagaggacagcaaatcaaagcaga
acctcccttcatgctagcagggatgagatcctacttggtagagatgcggctacttcaagt
ttggatgagctcaggattgttgaagataacgtctatgacaccatagtgcttccagaaaca
ccactgttgaaatttaaacatgatcccttaaaatgctctaaaaagcggagttttctgggc
ctggaaaaagacttgacatgttctgacaatctacagcagtttgtttctgaagagagtctc
cagttcagtgaagatgagagcccttaccatcgtcttcccattgacaatgactatctcagc
ttagtagatagctcttctaattccgactcgctgtcccataagtctgcagcagataaactc
tcagaggaagtagatgagatctggaatgacctggaaaactacatcaagaagaatcaggaa
aagacaagagatcggcatcttgcagcctttcctgtttgtaaagatgatatacaggaaaga
ctgcatgctggtagtacacctgaactgagtaaagatgtagagtactcaatgtctactctc
tctcttccagaaactccgattttccctaaaactgtgaaacccagggctgccacagtaagt
gaggctagtctcaggcttgaagatgctacggcatgcaaggaaagctctttagcaagtctg
aacagatcttccttcttgggtgagatgccatttgtggatagcccatacgaatctgccagt
agtgttctgtccaatacacatacagagtgcatggaaaatgacccggctattgtggataaa
acaaagaacagagtttttatgatggcaaggcaatacagtcagaaaattaagaaagctaac
cagcttttgaaagttaaaactcctgagcaggaacagccagctagtagacagcagaaactg
aagcacaaagaccttgctgctattctggaggagaagaaacaaggcggtcctgctatcggt
gccaggatagctgagtactcccagctttatgaccagattgtcttcagagacagctcaccc
aaggtccaaaaagaagcctgggccagccctcaggagccctcagccgtgaggttttccaca
cctctggctagcactcttccctgtgcccaggtcactggtgagtgctccagagcagaggat
tggcttttgcactctacctacagcaatggtgagctggctgacttttctccgtggccagaa
tcccaagacacgaagtccaagagctcatatgcagaagctgtgacaaaaagcaattccaga
cagctgccgtcagcctgctcagtgccttcccttcagatttctaaccgcttgcatgtcccg
gcgcagaggtggagtgcaattatcagccaacctaacaaagaaaatttacaccaagatcac
atctataactcccttgggagaagagtaagcagtatgaaaccacaggcatacagtaggtca
cagtcatcttcttcgattgtggtcaatagatctggagaatcaattgtatgtcctaatgaa
acagacaagaaaacacctcattccaataggaacttccgactcaatagccatcaagcgctg
ggtattgcttcagcctgtacagggcctgatatgaggaagcagatccctgagaactattcg
gatatgattttgcaggattctcaaaaggtcctgagagtaaacaggccctcccctctgact
gcacagatggcaactcagaactatttttctaacttcaaagacactgaagagggggaaggg
gatgatgatgactatgtggaaataaggtctgaagatgaggggtctgatctggaggcttct
cagaaccaaacaaggaaactggatcctaaattgcacaacacggacactgacccttctgaa
actctctgcggcaaaactgtgtcttgtactcctgcaaagcccaccggcagcaaacacacg
cttaccccgtatctgactgcatacagtgattcagataaactgaatgactacctgtggaga
gtgccatctcccagccagcagaatattgtccagtctttacgggaaaagtttcagtgtctt
agttccagtagctttgcttga

DBGET integrated database retrieval system