KEGG   Gallus gallus (chicken): 421692
Entry
421692            CDS       T01006                                 
Symbol
PDE7B
Name
(RefSeq) cAMP-specific 3',5'-cyclic phosphodiesterase 7B isoform X1
  KO
K18436  high affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7 [EC:3.1.4.53]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00230  Purine metabolism
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    421692 (PDE7B)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     421692 (PDE7B)
SSDB
Motif
Pfam: PDEase_I Cys_box
Other DBs
NCBI-GeneID: 421692
NCBI-ProteinID: XP_015139661
CGNC: 10424
Ensembl: ENSGALG00000013941
UniProt: A0A3Q2TZX9
Position
3:complement(55349437..55515244)
AA seq 499 aa
MPVLERFFPAAEPGRRRRTGEEPMPFPMGSLPGYQQGTLAWDLPEMIKMVKLVWKSKGEL
RGAKNRGVVESEDALGGSAGDARVRGQTGVLSERRGSYPFIDFRLLNNTTLSGEIGTKKK
VKRLLSFQRYFHASRLLRGIIPQASLYLLDEDYLGQARHMLSKVGTWDFDIFLFDRLTNG
NSLVTLLCHLFNVHGLIHHFQLDMVTLHRFLVMVQEDYHSQNPYHNAVHAADVTQAMHCY
LREPKLANFLTPSDIMLGLLAAAAHDVDHPGVNQPFLIKTKHHLASLYQNVSVLENHHWR
STIGMLRESRLLAHLPKEVTQDIEQQLGSLILATDINRQNEFLIRLKSHLDNQDLRLEDT
RDRHFMLQIALKCADICNPCRLWELSKQWSERVCEEFYRQGDLEQKFELEISPLCNQQKD
TIPSIQIGFMTYIVEPLFEKWAQFTGDTPLSENMLNHLRRNKAKWRSLLHKQHSSSRSND
HSGQVTGSQEQTLNEEETP
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgccggtgctggagcgcttcttccccgcggcagagccgggcaggcggaggaggacgggg
gaagagccgatgccctttcccatgggcagcctgcccggttatcagcaggggaccctggcc
tgggatttgcccgagatgatcaagatggtaaagctcgtttggaaatccaagggcgagctt
cgcggggcgaagaatagaggggttgtggagagcgaggatgccctgggcggctcggcagga
gatgcacgggtgagaggtcagacaggggttctctccgagcgccgcggctcctacccgttc
atagacttccgtcttcttaacaatacaacactctcaggggaaattggcaccaagaaaaag
gtgaaaagactgttaagttttcagaggtatttccatgcatcccggctactgcgtggaatc
ataccacaggcctctctgtacctgctggatgaggactaccttggacaagcacggcatatg
ctatccaaagtgggaacatgggattttgacattttcttgttcgaccgcttgacaaatgga
aacagtctcgtaacactgctctgtcacctcttcaacgtgcatggacttattcatcatttc
cagctagatatggttacattacataggtttttagttatggttcaagaagattaccacagc
cagaacccttaccacaatgctgtccacgctgctgacgtcacacaagctatgcactgctat
ctaagggaacccaagcttgccaacttcctcaccccatcggacatcatgcttggactgctg
gctgctgcagctcacgatgtggatcatccaggggtcaaccagccatttttaatcaaaaca
aaacaccaccttgccagcctgtaccagaatgtttcagtgctagagaatcatcactggaga
tctacgataggcatgcttagagaatcacggctccttgctcatctgcccaaggaggtgaca
caagacatcgaacagcagttaggctccctgatcttggcaacagacatcaacagacagaat
gagttcttgattcgtctgaagtctcaccttgacaatcaggatttgagactggaggataca
cgagacagacattttatgctccagattgcactcaagtgtgctgacatctgcaacccctgc
cggctgtgggagctgagcaagcagtggagcgagagggtctgtgaggagttctaccgccaa
ggtgacctggaacaaaaatttgaactggaaataagcccactttgtaatcagcagaaggat
acaataccaagcattcagattgggttcatgacgtacattgtagagccactctttgagaag
tgggcccagtttacaggcgatacccccttatctgaaaacatgctaaaccatctcaggagg
aacaaggcgaagtggaggagtttgctccataagcaacacagcagtagtaggagcaatgac
cactcaggtcaagtgactggcagccaggaacagacgttaaatgaagaagaaactccttag

DBGET integrated database retrieval system