KEGG   Gallus gallus (chicken): 421715
Entry
421715            CDS       T01006                                 

Gene name
RSPO3
Definition
(RefSeq) R-spondin-3 precursor
  KO
K23098  R-spondin 3
Organism
gga  Gallus gallus (chicken)
Pathway
gga04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    421715 (RSPO3)
SSDB
Motif
Pfam: Furin-like_2 TSP1_spondin
Other DBs
NCBI-GeneID: 421715
NCBI-ProteinID: NP_001305954
CGNC: 11001
Ensembl: ENSGALG00000042607
UniProt: M4M6X6
Position
3
AA seq 275 aa
MQLRLISWFFIALNFMEYIGSQHASRVRRQGRMHPNVSQGCQGGCATCSDYNGCLSCKPR
LFFVLERIGMKQIGVCLSSCPSGYYGTRYPDINKCAKCKADCDTCFTRNFCTKCKSGFYL
YSGKCLEKCPDGLEANNHTMECTSIVHCEASEWSPWSPCTKKGKTCGFKRGNEVRVREIV
QHPSARGNPCPATSESRKCMVQRKRCQKEGKGKKNREEKRKKSNKDESKESRQESKGRAA
RRQNREQRENNNKTQPKKRKAPSKEQDLTPVDTAH
NT seq 828 nt   +upstreamnt  +downstreamnt
atgcaattgcgactgatttcttggttttttatcgctttgaactttatggaatacattggc
agccagcacgcctccagggtacggcgacagggaagaatgcatcctaacgtgagccagggt
tgccaaggagggtgtgctacatgttcggactacaatggatgcctgtcatgtaagcccaga
ctcttttttgttctggagaggatcggcatgaaacagatcggagtatgtctttcctcgtgt
ccaagtggatactatgggacacggtatcctgacattaacaagtgtgcaaaatgtaaagct
gattgtgatacctgcttcaccagaaacttctgcacaaagtgtaaaagtgggttttactta
tacagtggaaagtgccttgaaaagtgccccgatgggctggaagccaacaaccacacaatg
gagtgcactagtattgtgcactgtgaagctagtgagtggagtccatggagcccttgcaca
aagaaaggaaaaacatgtggtttcaaaagaggaaatgaagtaagggtcagagagatcgta
caacatccgtcagcaaggggcaatccttgcccagctacaagcgagagcagaaaatgtatg
gtacaaagaaagagatgtcagaaggaaggaaaagggaaaaaaaatagggaggaaaaaaga
aaaaagtccaacaaagacgaaagtaaggagtcaagacaggaaagcaaagggcgagcagcc
cgaaggcaaaaccgagagcagagggaaaacaacaacaaaacgcagccgaagaaacgaaaa
gcccccagtaaagaacaggacctgacacccgtcgacactgcacattaa

DBGET integrated database retrieval system