KEGG   Gallus gallus (chicken): 421718Help
Entry
421718            CDS       T01006                                 

Gene name
HEY2
Definition
(RefSeq) hairy/enhancer-of-split related with YRPW motif protein 2
  KO
K09091  hairy and enhancer of split related with YRPW motif
Organism
gga  Gallus gallus (chicken)
Pathway
gga04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    421718 (HEY2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gga03000]
    421718 (HEY2)
Transcription factors [BR:gga03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    421718 (HEY2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH Hairy_orange dCache_2 HTH_Crp_2
Motif
Other DBs
NCBI-GeneID: 421718
NCBI-ProteinID: XP_015139928
CGNC: 66409
Ensembl: ENSGALG00000034716
UniProt: A0A1D5PW12
Position
3
AA seq 335 aa AA seqDB search
MKRPCEETTSDSDMDETIDVGSENNYCGQSHSSVLRPNSPTTTSQIMARKKRRGIIEKRR
RDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKGYFDAHSLAMD
FMSIGFRECLTEVARYLTSVEGLDTSDPLRVRLVSHLSTCASQREAAAMTSSMAHHHHPL
HPHHWAAAFHHLPAALLQPNGLHAPEAAPCRLSSEVPPHGSALLTATFAHTDAALRVPSA
GSVAPCVPPLSTSLLSLSATVHAAAAAATAAAQSFPLSFTSTFPMLPPSAAAAAVAAATA
ITPPLAVSASSSPQQAGSGASGKPYRPWGTEVGAF
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgaccttgcgaggaaactacctcagacagcgacatggacgagaccatcgatgtg
ggcagcgagaacaactactgcgggcaaagccatagctctgtgcttcgaccaaattcccca
accacaacatctcagattatggccagaaagaaaagaagagggattatagagaaaaggcgc
cgggatcgtataaataacagtttatctgagctgaggcggctggtgccaactgcttttgaa
aaacaaggatctgccaaattagaaaaagcggaaatactgcaaatgacggtggatcatctg
aagatgcttcaagcgaccggaggtaaaggttattttgacgctcactcactggccatggat
ttcatgagcattggcttccgggagtgcttgactgaagttgcgaggtacctgacatctgtg
gaaggcctcgacacctctgacccgctgcgtgtcagactggtgtcccatctcagcacctgc
gcctctcagcgggaagcggctgccatgacctcctccatggcccaccaccaccacccgctg
cacccgcaccactgggcagccgccttccaccacctcccggccgccctgctgcagcccaat
ggactccacgctcccgaggccgccccatgcagactctcctcagaagtgcctccccacgga
tctgcactgctcaccgctaccttcgcccacaccgacgccgccctcagggtcccctcagcg
ggcagcgttgctccctgtgtccccccactctctacctctctcctctccctctcggccaca
gttcatgccgcagccgccgccgccacggcagccgcccagagcttccccctctccttcacc
agcaccttccccatgctccccccaagcgcagctgctgctgcggtggcggcagctacagcc
atcacccctcccttggccgtgtcagcctcatccagcccccagcaggctggcagtggggca
agtggcaagccctaccggccttgggggacggaggtcggagccttctaa

DBGET integrated database retrieval system