KEGG   Gallus gallus (chicken): 421747
Entry
421747            CDS       T01006                                 

Gene name
FRK
Definition
(RefSeq) tyrosine-protein kinase FRK
  KO
K08892  fyn-related kinase [EC:2.7.10.2]
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gga01001]
    421747 (FRK)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     421747 (FRK)
Protein kinases [BR:gga01001]
 Non-receptor tyrosine kinases
  SRC family
   421747 (FRK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 B2 Kdo Kinase-like
Other DBs
NCBI-GeneID: 421747
NCBI-ProteinID: XP_419779
CGNC: 11129
Ensembl: ENSGALG00000014979
UniProt: E1C2F6
Position
3
AA seq 533 aa
MGNFCQKYCTCLEPCIPCLFSGKEGEREEDVGQVFANPAVVRIDSQAGEKDKVNKTKGKP
LPALPGQHLMNTCKFVALFNYEARTEDDLSFQAGDKLEVLDASHEGWWYAKLLLPEGSVC
PGRKLQGYIPANYIAAVQSIEAEPWFFGPIKRADAERQLLYPGNQAGAFLIRESESLKGE
YSLSVFDGQSVKHYRIRRLDGEGFFLSRMKTFKTLNEFVDYYSKNSDGLCVKLGKPCPKV
QIPTTFDLSYKTVDQWEIDRKSLKFLKKLGSGQFGEVWEGLWNNTTPVAIKTLKPGSMDP
KDFLREAQIMKNLRHPNLIQLYAVCTLEDPIYIVTELMKYGSLIEYLQNDAGSHISLPHQ
IDMAAQVASGMAYLESQNYIHRDLAARNVLVGEHSVYKVADFGLARVFKVENENIYEARP
ETKLPVKWTAPEAIRYNKFSVKSDVWSFGILLFEIITYGKMPYAGMPGHQVIQMLDKGYR
LPQPETCPKALYELMLKCWSTEPSERPTFEALYCQLEDYFDNDSYMDNRATIK
NT seq 1602 nt   +upstreamnt  +downstreamnt
atgggaaacttctgtcagaaatactgcacctgtttggagccctgtattccttgcttattc
tcagggaaagaaggtgagcgggaagaggatgttggccaggtctttgccaaccctgctgta
gtaaggattgactcacaggcaggagagaaggacaaagtgaataagacaaaagggaagccc
ttacctgcactgcctggacagcatttgatgaacacttgcaaatttgtggcactcttcaac
tatgaggctcgcacagaggatgacttgagcttccaagctggggataagcttgaagtgctg
gacgcatcccatgagggctggtggtatgctaagctcctcctgccagaagggtcagtctgt
cctggccgcaagctccagggctatatccctgccaactacatagctgctgtacagagcatt
gaagctgagccatggttttttggaccaatcaaacgagcagatgctgagagacaactgttg
tatcctggaaaccaggcaggagccttcctaatccgagaaagcgaaagtctaaaaggcgaa
tactcactttcagtgttcgatggtcaatcagtgaagcactacaggatcagaagactggat
ggagaaggctttttcttaagtagaatgaaaacttttaaaactctgaatgagtttgttgac
tattacagtaagaacagtgatggcctctgtgtgaagcttggaaagccatgtccgaaggta
caaattcctactacttttgatttgtcatacaaaactgttgatcaatgggagatagacaga
aaatctctgaaattcttgaaaaagttaggatctggtcagtttggtgaggtatgggaagga
ctgtggaataacaccaccccagtggcaatcaaaacattaaaaccaggttcaatggatcca
aaggactttctgagggaagcacaaataatgaagaacttgaggcatccaaatcttatacaa
ctttatgctgtttgcactttggaggacccaatttatattgttacggagctgatgaaatat
ggaagtcttatagaataccttcagaatgatgcaggctcccacatctccctgccacatcaa
atagacatggctgctcaggtggcttctggcatggcttatcttgaatctcagaactatatc
catcgagatttggcagccaggaatgttcttgttggtgaacacagtgtttacaaagtggca
gattttggacttgcgagagtttttaaggtagaaaatgaaaacatatatgaagctaggcct
gaaacaaaactcccagtgaagtggacagcccctgaggcaatccgctataacaaattcagt
gttaagtcagatgtgtggtcatttggaatacttctttttgaaataatcacgtatgggaag
atgccgtatgctggcatgccgggacaccaggtgatccaaatgctggacaagggatacaga
ctccctcagcctgagacctgccccaaggcactctatgaactgatgctgaagtgctggagt
acggagcccagtgagaggcccacatttgaggccttgtactgccagctggaggactacttc
gacaatgactcctatatggacaaccgtgccaccatcaagtga

DBGET integrated database retrieval system