KEGG   Gallus gallus (chicken): 421755Help
Entry
421755            CDS       T01006                                 

Gene name
AMD1
Definition
(RefSeq) S-adenosylmethionine decarboxylase proenzyme
  KO
K01611  S-adenosylmethionine decarboxylase [EC:4.1.1.50]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00270  Cysteine and methionine metabolism
gga00330  Arginine and proline metabolism
gga01100  Metabolic pathways
Module
gga_M00034  Methionine salvage pathway
gga_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    421755 (AMD1)
   00330 Arginine and proline metabolism
    421755 (AMD1)
Enzymes [BR:gga01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.50  adenosylmethionine decarboxylase
     421755 (AMD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAM_decarbox
Motif
Other DBs
NCBI-GeneID: 421755
NCBI-ProteinID: NP_001012587
CGNC: 11191
Ensembl: ENSGALG00000039575
UniProt: Q5F484
Position
3
AA seq 341 aa AA seqDB search
MKENGAHFFEGTEKLLEVWFARQQPAPQEPHQSKGSGDLRTIPRIEWDKLLENVHCLIIS
VTKTDKQEAYVLSESSMFVSKRRFILKTCGTTLLLQALVPLLELAREYSGFDSIQSFFYS
RKNFMKPSHQEYPHRNFQEEVEFLNEIFPNGAAYCMGRMNSDCWYLYTLDFPESRISNQP
DQTLEILMSELDPVVMDQFYMKDGVTANDVTRMSGIRDLIPGSVIDATMFNPCGYSMNGM
KSDGTYWTIHITPEPEFSYVSFETNISQTSYDDLIRKVVEVFKPGKFVTTLFVNQSSKCR
TVFSSAQKIEGFKRLDHQIAQFSDYNFVFTSFTKNRQQQHS
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagaacggtgcacacttcttcgaagggaccgagaagctgctggaggtgtggttc
gcccggcagcagcccgcgccgcaggagccgcaccagagcaaggggtccggcgacctccgc
accatacccaggattgagtgggacaaacttctggagaatgtgcattgtttgatcataagt
gtgacaaaaactgacaagcaggaagcttatgtactcagtgagagtagcatgtttgtctcc
aagagacgtttcattttgaagacgtgtggtaccaccctcttactgcaagcactggttccc
ctgttggagcttgctagggagtacagtgggtttgactcaattcagagcttcttttattca
cgtaagaatttcatgaagccttcccaccaggagtacccacataggaatttccaggaagaa
gtggagtttcttaatgaaattttcccaaatggagcagcttattgcatgggacgtatgaat
tctgattgctggtacctgtacaccctggatttcccagagagtcggatatccaatcagcct
gatcagacactggaaattctgatgagtgagcttgacccagtagttatggaccagttctac
atgaaagatggtgttactgcaaatgatgtcactcgtatgagtggaattcgtgacctgata
ccaggttctgttattgatgctacaatgttcaatccttgtgggtattcaatgaatgggatg
aaatcggatggaacttactggactattcacatcactccagaaccagaattctcttacgtt
agttttgaaacaaacataagtcagacttcttatgatgacctgattagaaaagttgtagag
gttttcaagccaggaaaatttgtaacaaccctctttgttaatcagagctctaaatgtcgc
acagtgttttcttctgctcagaagattgaagggtttaaacgtcttgatcaccagattgct
caattcagtgattacaattttgtttttaccagtttcacgaagaatcgccagcaacagcac
agttga

DBGET integrated database retrieval system