KEGG   Gallus gallus (chicken): 421761Help
Entry
421761            CDS       T01006                                 

Gene name
WASF1
Definition
(RefSeq) wiskott-Aldrich syndrome protein family member 1 isoform X1
  KO
K05753  WAS protein family, member 1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04520  Adherens junction
gga04810  Regulation of actin cytoskeleton
gga05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    421761 (WASF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    421761 (WASF1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    421761 (WASF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:gga04812]
    421761 (WASF1)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     421761 (WASF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WH2
Motif
Other DBs
NCBI-GeneID: 421761
NCBI-ProteinID: XP_004940365
CGNC: 11206
Ensembl: ENSGALG00000015066
Position
3
AA seq 585 aa AA seqDB search
MRAASFIRERKSLRFAGPLIPFRMPLVKRNIDPRHLCHTALPRGIKNELECVTNISLANI
IRQLSSLSKYAEDIFGELFNEAHSFSFRVNSLQERVDRLSVSVTQLDPKEEELSLQDITM
RKAFRSSTTQDQQLFDRKTLPIPLQETYDICEQPPPLNILTPYRDDGKEGLKFYTNPSYF
FDLWKEKMLQDTEDKRKEKRKQKQKNLDRPHEPEKVPRAPHDRRREWQKLAQGPELAEDD
ANLLHKHIEVANGPASHFETRSQAYVDHMDGSYSLSALPYSQMSELLNRAEERVLVRPHE
PPPPPPMHGAGDAKPVPPCVSSTTGLVENRPQSPATGRPPVFVSPTPPPPPPPPLPSALS
TSSLRAAMTSTPPPPVPPPPPPPAAALQAPAVPPPPAPLQIAPGVLHPAPPPIAPPLAQP
SPPVTRAAQVCEAVPVHPVPPQGEVQGLPPPPPPPPLPPPGIRPSSPVTVAALSHPTPVL
HPPPTTIVPGPHAPLMPPSPPSQVIPAPEPKRHPSTLPVISDARSVLLEAIRKGIQLRKV
EEQREQEAKHERIENDVATILSRRIAVEYSDSEDDSEFDEVDWLE
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgagagctgcatcttttataagagagaggaaatcgcttaggtttgctggtcctctgata
cctttcagaatgccgctggtaaaaagaaacatagaccccaggcatctgtgccacacagct
ctgccccgcggaatcaagaatgagttggaatgcgtcaccaatatctccttggcaaatata
atcagacaactgagtagcttaagtaaatatgctgaagatatatttggggaacttttcaat
gaagcacacagtttctcatttagagtcaactccttacaggaacgtgtagatcgcttatct
gtcagtgttacacaacttgatccaaaggaagaggaactatcattgcaggacattaccatg
aggaaagctttccgcagttccacaactcaagatcaacagctgtttgaccgcaaaactctg
cctattcctttgcaagaaacttacgacatttgcgaacagcctcctcctcttaacatcctc
accccttacagggatgatggaaaagaaggtctgaagttttataccaatccttcatacttc
tttgacctgtggaaggaaaagatgttacaggacactgaggacaaaagaaaagaaaagagg
aagcagaagcagaaaaatctagatcgccctcatgaaccagaaaaagtgccaagggcacct
catgacagacggagggagtggcagaagctagcccaaggtccagagcttgcagaagatgat
gctaacctcttacataagcacattgaagttgctaatggcccagcctcacattttgaaacc
agatctcaagcatatgtggaccatatggatggatcatattctctttctgcgttaccctat
agccagatgtctgaacttctgaacagagctgaggagcgagtgttggttcgaccacatgaa
ccaccaccaccacctccaatgcacggtgcaggagatgcaaaacctgtgcctccttgtgtt
agttctactactggattggtagaaaaccgtcctcaatcaccagcgacaggcagaccacca
gtgttcgtgagccccactcctcctcccccaccaccaccacctcttccatctgctttgtcc
acctcatcactacgagctgcgatgacttccacaccacctcccccagtcccacctcctccc
ccacctcccgctgctgctctgcaggccccagccgtgccacctccgccagctcctctccag
atagctcctggggtcctacatccagctccacctccaattgcccctcccctggcacagccc
tccccacctgtcactagagctgcacaagtgtgtgaagcggtaccagtccacccagttcct
cctcaaggtgaagtacagggacttcccccaccacccccacctcctcccttgccgcctcct
ggcattcggccctcttctcctgtcacagttgcagccctttctcaccccactcctgttctt
caccctcctcccacgaccattgttcctggccctcatgctcctctcatgcctccatctcca
ccgtcccaagtgattcctgctcctgaacccaaacgccacccttcaactcttcctgtaatc
agtgatgctagaagtgtgctgctggaagcaatacgaaaaggtattcagctgcgtaaagtt
gaagagcaacgcgaacaagaagctaaacatgagcgcattgagaatgatgttgctaccata
ctttctcgtcgcattgctgtggagtacagcgattcagaagatgactcagaatttgatgaa
gtggattggttagagtaa

DBGET integrated database retrieval system