KEGG   Gallus gallus (chicken): 421783
Entry
421783            CDS       T01006                                 

Gene name
AIM1
Definition
(RefSeq) beta/gamma crystallin domain-containing protein 1 isoform X1
Organism
gga  Gallus gallus (chicken)
SSDB
Motif
Pfam: Crystall IL4_i_Ig Ricin_B_lectin
Other DBs
NCBI-GeneID: 421783
NCBI-ProteinID: XP_004940405
CGNC: 11429
Position
3
AA seq 1923 aa
MPAERPPPAQRCPRCRPGSGRRRAGIPAQPLSSRRRGAELGMARRGRFQRLFGRSESEDS
EPEGAAASPRRRPPAAAPKRRSAFPQWRPKRKEPQPPARGTPPAAPLSLQEPPPLRYYDI
SGTRYTVQESQLPSVICPHSYVLPSISMSTASLPAALRKSSSQFPDCSREEHKKKPVLER
LGNLFGTGRRKNVKSSLERSSHWKGERSVSPHTAQPVYCKHIQQGPESPPVQKQARNTSV
VPETREYSFSGEVGPLYHDTVSEWSGRGVSSDSEWSPDWSSSSETIKNSFFESSLNVDTQ
EPEKESVTDINNSTTPDFIKSLRNLSSEDLEKSILSHKHLVNTWVSEEPGHAKPKDLPYK
LETLASEHPQPARVLTVDIYLRKTEELLNEPVTVISEENCGDSDTMDKKSSSKRSGKRRK
SQSSSDIPNGERNQTENTAREDSVFEDDASSEGFPEKVITSERKLKSPQQTPERNSFSSS
NNPDLKAGSAHKGTSKTDADKGKQQASNTTPARRRSYKKNQLDAVPTSPTGLKSQVKDYS
SKRHPLASTESNPMTKRTLQEKGTLPGAFGEDSLESPKVSSADKAEDSTVVFAEGRNETK
TEKHGNDSDGRAFSRTDKIKNGDLCMPAERQTSSDLDSLKLKSLDASRIVTTKISLARTE
KNLGRCLQNLLESPAKPKNVELNFKAPTNQDSLESEQDTLEKPVNKNNNSIANKISLFEN
KCASQSQRPTDISASKNSTVPSTFVGRAKLIFGKQPKESEQPDKTLNKQNSRQKLFENGT
AEKDSTAELKGKNEEGSAPYEDIGKGTELKVKAAISLFNQSSKIDASGASLKQPDPELSA
VKKESSPFKQSLHSPVKSESVHDISYQQNNTSSELPRNEEKVPPDTEVLSTCNGDKYHLQ
SHQLCRPESQKVENGDKNAKPGDLTFEAQQYDDNSVNGILVSEHSNNTPESPGKTCNGST
EDDAIFDSPTDMKKFAETIKNLDSSVCLPQKKKRSKLPKSPAPHFAMPPIHEDNLEKVFD
PSVFTFGLGLRREKAQDLLPTQQMKMQSLETIARVRPKRASTEQSIIFKALQSCNREEPA
FTQEINGKENMDGTDGEVKRSRLEKSSLFSSLLSSASKEKFLNPSVTSVNNATFIADSSG
IPSLQQDASGPFILPQKPESLSDMKFPSYMEKYIQADSAKKELSLQIPNYGNPEKNFSSW
LGANRYESNVPTGLLDVDTLSRNGQSKINPRPGKLVIYCESDNQENVIEVFHDVLDCSSW
VLSPTILVKVIRGCWILYEKPNFEGPSIPLEEGELELPDIWGAGEEQNECGSLKPAVIGS
IRHVVKDYRVSQIDLYTEPEGLGIVTSFFDDTEETGVFGSTQKTCSIKVHWGIWLIYEEP
GFQGVPLMLEPGEYPNLAFWEKKEAYIRSMRPLKMGGRKVECPGDPKVVIYEKPFFEGRH
VEVESEIFTLSDKESEEKTRLSLTSVGSIKVLGGVWVAYEKPGFEGHQYLLEEGEYRDWT
DWGGYDEELQSLRPVVGDFTSSHMIMYSEKDFGSKGSNINVLGIVSNLKDTGYGLRTQSI
NVLSGVWVAYENPEFTGEQYILDKGLYPNIEAWGGKNCKISSVQPIVMDIGGSERGKVKV
QLFSEPEFKGNCQILEKNTGCIDSFTVKSSKVLGGSCIVFDQEEFSGNQYVLEEGIYPDL
MAMGCSSQAALKSLRIINIELSEPCIALFEKVGFQGRKIEFTTEVLNLQFLGYNPRIASV
QVLGGTWIIYEHSNYRGRQMLLSPNEIPDWYKLSGCCQIGSLRPLLQKRVYFRLRNKETG
KFMSTDGNLDNLNLLRIQAAEDVDSDDQIWLYQDGFIRCRMAEDCCLTIVGNLITPGSKL
GLSFERNEDKQYWHISPDGRIYSKMKPKLVLDIKGGTQYDRDHVVVNTVNEEKLTQCWEP
LVV
NT seq 5772 nt   +upstreamnt  +downstreamnt
atgcccgcggagagaccgccacccgcgcagcgctgccctcggtgccgccccggctccggc
cgccggcgggcgggcatccccgcgcagcccctctcttcccgccgccgcggcgcggagctc
ggcatggcgcggcggggacgcttccagcgcctcttcggccgcagcgagtctgaggactcg
gagcccgaaggggcggccgcctccccccgccgccggccccccgccgccgcgcccaagcgg
cgctccgcgttcccccagtggcgcccgaagaggaaggagccgcagccgcccgcccgcggc
acgccgcccgccgcgcccctcagcctccaggagccgccgccgctgaggtactacgatata
tcaggcacacgctatactgttcaagagagccaactaccatcagtaatctgtccacactct
tacgttcttccatcaatatcaatgtctaccgcctcattaccagcagcacttaggaagtcc
tcctcacaatttccagattgttccagagaagagcataaaaagaaaccggttttggaaaga
cttggaaatttgtttggtacagggagaaggaaaaatgtcaaaagttcgttagaacgctct
tctcattggaaaggagagaggtcagtttcgcctcacacagcacagcccgtttactgtaaa
catatccagcaaggtcctgaatctcctccagtacagaagcaagcgagaaacacgagtgtc
gttcctgagacacgggaatatagtttcagtggggaagtaggacctctataccacgatacc
gtttcagaatggagtggtcgaggagtctcctctgacagtgagtggtcgccagactggagc
agcagcagtgaaaccattaaaaactctttctttgagagtagcttgaatgtggacacccag
gaaccagagaaggagtctgtcacagatataaataattccacaactccagattttataaaa
agcttgaggaatttgtctagcgaagacttagaaaagagtatcttaagccacaagcatctg
gtgaacacgtgggtgtctgaagagcctgggcatgcaaagccaaaggatttgccatacaag
ctggaaactctagcaagtgaacacccacagcctgctagagtgttaacagttgatatttat
cttagaaaaacagaggaactccttaatgaacccgtgactgttatatcggaagaaaattgt
ggtgactcagacacgatggataagaaatcttctagtaaaagatctgggaaaaggagaaaa
tctcagtcatctagtgacattccaaatggagagagaaaccagactgaaaataccgcaaga
gaagattctgtttttgaggacgatgcatcttctgaggggtttccagagaaggtaataacc
tcagaaagaaaacttaagtctcctcaacagactcctgaacggaattccttttcttcaagt
aataatccagacctaaaagctggatctgctcacaaaggcacgtccaagactgacgctgac
aaaggtaaacagcaagcctcaaacacaacccctgcgaggagaagatcttataaaaagaat
cagttggatgctgttcctacttcccccactggtttgaagagtcaggtgaaagattactcc
tcaaaaaggcatcctttagcatcaacagagagtaacccaatgacaaaaagaactttgcag
gaaaaaggaactctacctggggcttttggggaagacagtttggaatctcccaaagtctca
tcagccgataaggcagaagacagcaccgtggtgtttgctgaaggcagaaatgaaaccaag
acagaaaagcatggtaatgattctgatggaagagctttctcacgtactgataagattaaa
aatggagacctatgtatgccagctgagagacagacaagttctgatttagacagcttgaag
ctgaagagtttggatgcttccagaatagtcacaacaaaaattagccttgcaaggactgaa
aagaatctgggcagatgtcttcaaaacttgttggagagtccagccaaaccgaagaatgta
gagctgaattttaaggcgcctactaatcaagacagtttagaaagtgagcaggatactctt
gaaaaaccagttaataaaaataacaacagcattgccaacaaaatttccttgtttgaaaat
aaatgtgccagtcagagccagaggcctactgatatttctgcttcaaaaaatagtaccgta
ccaagcacgtttgttggtagagcaaagctgatatttggaaaacaacctaaggaaagtgaa
cagcctgataaaacattaaataagcaaaacagtcgccagaagttatttgagaacggcaca
gcagagaaagatagcactgcagaattaaaaggcaaaaatgaagaaggctctgcaccttac
gaggatattgggaaaggaacagagcttaaagtaaaagctgcaatatctctttttaaccaa
agcagcaaaattgatgctagtggtgcttctctgaagcaacctgatccagaattaagtgca
gttaaaaaggaaagttctccttttaaacagtctttgcactcacctgttaaaagtgaaagt
gttcatgatatttcctaccaacaaaataacacaagctcagaactgcccagaaatgaagag
aaggtaccgccagacacagaggtcttatcaacctgcaatggtgataaatatcatctacaa
tctcatcagctttgtagaccagaatctcagaaggtggaaaatggagataaaaatgcaaag
ccaggagatctgacctttgaagcacagcagtatgatgacaatagtgttaatggtatattg
gtgtcggaacacagcaataatactccagagagcccaggcaaaacttgtaatggctctacg
gaagatgatgctatttttgattctccgaccgacatgaagaagtttgctgaaacaataaaa
aacttggacagctctgtttgtttaccacagaagaagaaaaggtcaaagcttcccaaatct
ccagcaccccacttcgcaatgcctccgattcatgaagacaatttagagaaagtatttgat
cctagtgtatttaccttcggtttgggactgagaagggaaaaagcacaggatctgttacca
acccaacaaatgaaaatgcaaagtctggaaacgatagccagagtcaggcccaagcgtgca
tcaacagagcaaagtataatattcaaagcccttcagtcatgtaatagagaggaacctgcc
tttactcaggaaataaatggaaaagagaacatggatggtacagacggtgaagttaagaga
tcccggctggaaaaaagctcactcttctcaagcttgctgtcatctgcttctaaagaaaag
tttcttaatccttctgtgacctcagtaaataacgcaacttttatagcagactcctcagga
ataccttctttacaacaggatgcttctgggccattcatcctgcctcaaaaacccgagtct
ctttcagatatgaagtttccaagttatatggagaagtacatacaagcagatagtgcaaaa
aaagagctaagtttacaaatacctaactatgggaacccagaaaaaaacttttccagctgg
ttaggggcaaacagatatgaatcaaatgtccccactggtttattagatgtagatacactt
tcaagaaatggacaaagtaaaatcaatcccaggcctgggaagctggtgatttactgtgaa
tcagacaatcaagagaatgttattgaagttttccatgatgttctggattgcagttcttgg
gttctgtcaccgacaatcttagttaaagttatcagaggatgctggatactctatgaaaaa
ccaaattttgaaggtccctctattcctctggaagaaggagaactggaactcccagatatt
tggggtgcaggtgaagaacaaaatgaatgtgggtcgctaaagcctgcagtgattggttca
ataagacatgttgttaaggattatagggtcagtcaaattgatttgtatacagaacctgaa
gggctaggaatcgtgacttccttttttgacgacacagaggaaacaggagtgtttggcagc
actcagaagacctgttctatcaaagtacactggggcatatggctaatttatgaagaaccc
ggtttccagggagtccctttaatgttggagcctggtgaatatcccaatttagctttctgg
gagaagaaggaagcctacattaggtctatgaggcccttgaaaatgggtggccgcaaagta
gaatgtcctggagatccaaaggtagtcatttatgagaagcctttctttgaagggagacat
gtggaagtagaatcagagatctttacactgagtgacaaggaatcagaagaaaagacacga
ctttcgcttacgtcagtgggatccatcaaagtactgggaggagtgtgggtcgcgtatgaa
aagcctgggtttgaaggccatcagtatttactggaagaaggagaatatcgggactggaca
gactggggtggctatgatgaagagctgcagtcactgagacctgttgttggtgacttcaca
agctcacatatgataatgtacagtgaaaaagactttggatcaaagggttccaacattaat
gtgttaggaattgtttccaacttgaaagacactggatatgggctgagaacacaatctata
aatgtgctaagtggcgtgtgggtggcttatgagaatcctgaatttacaggggagcagtac
atactggataaagggctatatcccaacattgaggcatggggggggaagaattgcaaaata
tcttcagttcaacccattgttatggatattggtggaagtgaaaggggtaaagtcaaggtc
cagttattttcagagcctgaattcaagggtaactgtcaaatacttgaaaaaaacacagga
tgtattgattcatttactgtgaagtcttcaaaagttttaggtggcagctgcatagttttt
gaccaggaagaattctctggtaaccagtatgtgttagaagagggaatctatccagatctg
atggcaatggggtgttcatcccaagcagctctgaaatctttacggattataaatatagag
ctgtctgagccatgcatagctctttttgaaaaggtgggtttccaaggaagaaaaatagaa
ttcactacagaagtcttaaatctccagttcctgggatataatcctcgaatagcttcagtt
caagtccttggtggcacatggataatttatgaacatagtaattacaggggacgtcagatg
ttgctgtcaccaaatgaaattccagattggtataaactgagtggctgctgtcagataggt
tctctgagacctttgctgcagaaacgtgtgtacttcaggcttcggaacaaggaaacagga
aagttcatgtcaactgatggaaacttggacaatttgaatcttctcagaatacaggctgca
gaagatgtagattcagatgatcaaatctggctttatcaggatggattcataagatgccgg
atggcagaggattgctgcttgacaattgttggaaatcttataactcctggctctaaactt
ggtctgtcatttgagcggaatgaagacaaacagtattggcatattagtcccgatggcagg
atttacagcaagatgaaacctaagctggttttagatatcaaagggggcacacaatatgat
cgtgatcacgttgttgtcaacacagtcaacgaagaaaagttaacacagtgctgggaacca
ctggttgtgtaa

DBGET integrated database retrieval system