KEGG   Gallus gallus (chicken): 421862Help
Entry
421862            CDS       T01006                                 

Gene name
CD109
Definition
(RefSeq) CD109 antigen
  KO
K06530  CD109 antigen
Organism
gga  Gallus gallus (chicken)
Brite
KEGG Orthology (KO) [BR:gga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gga01002]
    421862 (CD109)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:gga04090]
    421862 (CD109)
Peptidases and inhibitors [BR:gga01002]
 Peptidase inhibitors
  Family I39: alpha2M family
   421862 (CD109)
CD molecules [BR:gga04090]
 Proteins
  421862 (CD109)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TED_complement A2M A2M_BRD A2M_recep MG3 MG2
Motif
Other DBs
NCBI-GeneID: 421862
NCBI-ProteinID: XP_419879
CGNC: 11871
Ensembl: ENSGALG00000015910
UniProt: F1NX21
Position
3
AA seq 1446 aa AA seqDB search
MARSRAAVHLLLLFLACGSAEAGPTFLVAAPWNIRPGASVTVGVALLPGSPAQVAVRGAL
LRDNQTVLSRELVFERDSFGTLVLPVLPLESPSGTYELLVEGYADGQRVFSNRTSLIYTS
KSISVFIQTDKSTYKPGQDVMFRIVTVYPDLKPYKASLNIYIRDPRKKLIQQWLLEEGDL
GVVSKKFQLSKNPPLGDWSLDVEVNGQVHYQSFKVMEYVLPKFDVTITAPLYYSLREKEV
TGVVTAKYTYGKPVKGNVTVTCLSVSYWTNKRNITKTMEINGSVNITCNKLLLQNMNGDQ
SWHHDDDDYTEPVEIIAVVTESLTGISQNSSTIIFPKQSDYFIEFVDYSRVIKPSLNFIA
TLKVTHSDSNQLTTEERQNLVTVTAQQSDMFFHHSSLSHFENEATEERNKTVHVLNYTVP
ENGIIDIEFPILSNTKTLRVQAEFLNSKTDIGVYDVFSSPSETYLQVKTKSQEVKAGKPF
ELNIESNKPVREFHYLVLSKEQIMTSGTMVAKAFNLTAENSWAPLACILVFYVDELGAVV
NDALTIPVQPALDNKIKISWSKDKVKPSEKVSLKISTTDPESVIGLAVVDKSTKLLGESS
DITEDSVFHELNLYNTAQYFPLVRGSFGVFQKCSLWVSTDAILEEDKEHFLYDGMIPIED
GFGDDLPVAREGALDFSTPYVRTHFPETWLWIDTKTRFDADTTMEVTVPDTITSWVASAF
VLSENGGLGVTTVPAELEAFQPFFVFMNLPYSVVRGEQFILEVNIYNYRKEEAEVNVILD
MNDAFEIILTSNEINATGNQQSIFVPSEDGKTVQFPIKPKQLGEIPIKVTAISSAASDAI
IQKVLVKAEGLEQTYSQTLLLDLTGSKQQAMTKTLDFTFPPDVVSGSERVQVTAIGDLLG
PSINGLSSLIKMPYGCGEQNMINFAPNVYILQYLTKTRQLREDIQSKALSFMRKGYQREL
LFQRDDGSFSAFGNEDPSGSTWLSAFVLRCFFQARPFIDIDQDVLMDTAKWIVGHQKSNG
EFQEPGKVLHSDLQGGTNNPITLTAYIMSSLLGFQDKEHAYVIKRATNFLEDKLKEGISD
NYTLALVTYALSWAKSTKAKEALSMLNERAERQGEFRFWITPASEISDSWQPRSIDIELA
AYALLSHFHQDRLEEGIPIMKWLSQQRNHLGGFSSTQDTVVALQALSLFAALTSAHKTDM
DITVTATSLETPEIFSIDTQNRFLLQTKEIPPVQPMTVTVSAEGRGFAVFQLNVIYNTKH
TDRRLRSVQKQKAFDLTVDVKDDKDDMNHMTLNVCTRYLGSDTSPNSGMVLMEVGLLSGF
SVSPDFIPLDNTVKKMEKENGKVNLYLDTLNATQFCMDIPTARDFKVANIQDASVTVVDY
YEPRRRAVRSYNSEVMQSITACDFCESDCNLCHRAGSSALLQHSSLASLFCVLFVLHVNL
LCSWVL
NT seq 4341 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggagccgcgccgctgttcaccttctcctcctcttcctcgcgtgcggctccgcc
gaggctggacctacgttcctggtggcggccccctggaacatcagacccggagcgagcgtc
accgtcggggtggccctactgcccggcagccccgcgcaggtcgccgtgcggggtgcgctg
ctcagggacaaccagacagtgctcagcagggagctggttttcgagagagattcctttggg
actcttgttcttccagtattgccattggaaagtccttctgggacttatgaattactggtg
gaaggctatgctgatggccagcgcgtcttctctaaccgtaccagcttaatatacacgtca
aagagtatctctgtcttcattcagactgataaatctacatacaaaccaggacaggatgtc
atgtttcggattgtcacagtctatcctgatctcaaaccttacaaagcttctctaaatata
tatatccgagacccacggaagaagttgattcagcagtggttgctggaggagggtgattta
ggtgtagtttcaaaaaaatttcagttatcaaagaaccctccactaggagactggtcctta
gacgtggaagtgaatggtcaagtacattatcaaagttttaaagtgatggaatatgtttta
ccaaaatttgatgttacgataacagcaccattatactactccttgagagagaaagaagta
actggtgttgtcactgcaaagtatacatatggaaagccagtgaagggaaatgtgactgtc
acctgcctatctgtctcttactggacaaacaagaggaatataacaaaaacgatggagata
aatggatctgtgaatattacttgtaacaagcttctgttgcaaaacatgaatggggatcag
tcatggcaccacgatgacgatgattacactgagccagtagagattattgctgtggttact
gagtcactcacaggaatctctcaaaattcaagtactatcatatttccaaagcaaagtgac
tatttcattgaatttgtggactactctagagtcataaaaccttctctgaatttcatcgct
actctgaaggtgacacattctgatagcaaccagctgacaactgaggagaggcagaatctc
gtcacagtcactgcacaacagtcagatatgttttttcaccactcttcactttctcacttt
gagaatgaggcaacagaggagagaaataagacggtccatgtcctgaattacacggtccca
gaaaatggaattattgatattgagtttccaatcttatccaatacaaaaactttgagagtt
caggcggagttcctcaacagtaagactgacataggcgtttatgatgtgttcagctctcct
agtgaaacttatctccaggttaaaacaaagagccaggaagtgaaggctgggaaacctttt
gagctaaatattgaaagcaacaagccagtaagagagttccattatctggtgttatctaag
gaacaaattatgacttctggcacaatggttgcaaaagcattcaatttgacagcagaaaat
tcctgggctcctctggcatgtatacttgtattctatgttgatgaacttggagcagttgta
aatgatgctcttacgatccctgttcagcctgctttggacaacaagattaaaatttcttgg
agcaaagataaagtcaaaccatctgagaaagtttcccttaagatcagtacaacagaccca
gaatcagtaattggacttgcagttgtcgataaaagcacaaagcttctaggagaaagtagt
gacataacggaagattctgtatttcatgaactcaatttatacaatacagcacagtatttc
cccctggtcagaggttcttttggtgtctttcagaaatgcagcctttgggtatcaactgat
gcaattcttgaggaggataaagaacattttctttatgatggaatgatacccatagaggat
ggctttggtgatgatctgccagtagctagagaaggagctctagatttcagcactccgtat
gtgaggacacattttccagagacttggctttggatcgataccaaaactagatttgatgca
gataccacaatggaagtcactgtacccgataccatcacgtcctgggtagccagtgctttt
gtgctttctgaaaatggcggtcttggagtgacaactgttccagcagagctagaagctttt
caacctttcttcgttttcatgaaccttccgtactctgtcgtcagaggagagcagttcatt
ttggaagtgaatatctataattatcgaaaagaagaagctgaggttaatgtgatcctggat
atgaatgatgcttttgaaataattctaacatctaatgaaataaatgctacaggaaatcaa
cagtctatatttgtaccaagtgaagatgggaaaactgttcaatttccaatcaaaccaaaa
cagctgggagagattcccatcaaagtgacagcaatatcatctgctgcttctgacgctatc
atccaaaaagttttagtaaaggctgaaggattggaacagacatattctcagacactcctt
ttggatttaactggaagtaaacaacaagcaatgacaaaaactttggatttcacttttcct
cctgatgttgtaagtggcagtgaaagagtgcaggttactgctataggtgatttacttgga
ccttcgatcaatggtttgtcatcattgattaagatgccttatggctgtggtgaacagaat
atgatcaattttgctccaaatgtttatattttgcaatacctcactaaaaccagacagctg
agagaggatattcaatcaaaagctttatcatttatgagaaaaggatatcaaagagagctg
cttttccagagggatgatggctcttttagtgcctttggaaatgaagatccctctgggagc
acatggttatcagcttttgtattaagatgtttttttcaagctcgtccgttcatagatatt
gaccaagatgtactcatggatacagctaaatggattgttgggcatcagaaatcaaatgga
gaatttcaggaacctggcaaagtgttacacagtgaccttcaaggaggcaccaataatccc
atcactctcacagcatatatcatgtcttccctcctcgggttccaagataaagagcatgct
tatgtcattaagagagctacaaactttctggaagataaactaaaagaaggcatttcggat
aattatacattagcacttgtgacgtatgctttgtcatgggcaaaaagtacgaaagcaaag
gaagctttgagtatgctgaatgagagagcagaacgacaaggagaatttcgtttctggata
acacctgcttctgaaatttctgattcatggcagccacggtccattgatattgaacttgca
gcatatgctctgctctcacactttcatcaggacaggttggaggaagggatacctattatg
aaatggttaagtcagcaaagaaatcatcttggaggattttcatctacacaggacactgta
gtggctctgcaagccttgagcctatttgcagctcttaccagcgcacacaaaacagacatg
gatataacagttactgcaacttctttggaaactccagaaatattttcaattgatactcaa
aaccgttttctgcttcaaaccaaggagattccccctgtgcaaccaatgacagttacagtt
tcagcagagggaagagggtttgctgtctttcagctcaacgttatttacaacacaaaacac
accgatcgaaggctcagatctgtccaaaaacaaaaagcttttgacttgactgttgatgta
aaggatgacaaagatgatatgaaccatatgaccttgaatgtgtgcacaaggtacttgggg
tctgatacatctcccaatagtggtatggtcctcatggaggttggcttactcagtggtttc
tctgtgtcacctgatttcattccattagacaatacagttaagaagatggaaaaggaaaat
ggaaaagtcaacctatacttagacactctaaatgcaacacagttttgtatggatattccg
actgcgagagacttcaaagtggcaaatattcaagatgcttctgtgactgtagtggattac
tacgaacccaggagaagagcagtgagaagctacaattcggaagtaatgcaaagcataacc
gcttgtgacttctgtgaaagtgattgcaacctttgccaccgagctggctcttcagccctg
cttcagcactcttccttggcttccttgttctgcgtgctgtttgtccttcatgtaaacttg
ctgtgcagttgggtgctgtaa

DBGET integrated database retrieval system